On the Trace of Agile Leadership: The Alphabet of Principles and Practices for Human Work
The Most Addictive Game On The Web!
Search settings | Sign in
Advanced search
About 29,400 results (0.24 seconds) 
Sponsored link

      Wika Gauges - Buy Online
      www.wikagauges.com      From F.N. Cuthbert Inc. In Stock - Wide selection

Tip: Search for English results only. You can specify your search language in Preferences
Search Results

       - [ Translate this page ]
      22 Jun 2010 ... PT Wijaya Karya (Persero) Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, Tangerang and Bekasi ...
      www.wika.co.id/ - Cached - Similar
      BERANDA - Wika.co.id
       - [ Translate this page ]
      PT Wijaya Karya Tbk (WIKA) bersama PT Adhi Karya Tbk, PT Hutama Karya, PT Nindya Karya, PT Pembangunan Perumahan dan PT Waskita Karya menyalurkan bantuan ...
      www.wika.co.id/ina/index.php - Cached
   3. [PDF]
      Indo Premier Securities, 5 November 2009 - INDOPREMIERSECURITIES ...
      File Format: PDF/Adobe Acrobat - Quick View
      5 Nov 2009 ... Refer to important disclosures on the last page. INDOPREMIERSECURITIES. EQUITY RESEARCH. PT WIJAYA KARYA TBK. Company Update ...
   4. [PDF]
      Indo Premier Securities, 12 October 2009 - INDOPREMIERSECURITIES ...
      File Format: PDF/Adobe Acrobat - Quick View
      Refer to important disclosures on the last page. INDOPREMIERSECURITIES. EQUITY RESEARCH. PT WIJAYA KARYA TBK. Initiating Coverage. 12 October 2009 ...
   5. [PDF]
      File Format: PDF/Adobe Acrobat
      Joint Lead Underwriters. PT Bahana Securities (Affiliated). PT CIMB-GK Securities Indonesia. PT Indo Premier Securities ...
      Show more results from wika.co.id
      WIKA Mail- Login
       - [ Translate this page ]
      Welcome, Login to Portal ...
      webmail.wika.co.id/ - Cached - Similar
      Portal WIKA : Spirit Of Innovation
       - [ Translate this page ]
      Username Password.
      portal.wika.co.id/ - Cached - Similar
      22 Jul 2010 ... lotus.wika.co.id has one IP number ( Wika.co.id is a domain controlled by two name servers at net.id. Having a total of four ...
      www.robtex.com › dns › id › co.id › wika.co.id - Cached
       - [ Translate this page ]
      mail.wika.co.id has one IP number ( Wika.co.id is a domain controlled by two name servers at net.id. Having a total of four IP numbers.
      www.robtex.com › dns › id › co.id › wika.co.id - Cached - Similar
       - [ Translate this page ]
      Wika.co.id is a domain controlled by two name servers at net.id. Having a total of four IP numbers. Some of them are on the same IP network.
      www.robtex.com › dns › id › co.id - Cached - Similar
      mail.wika.co.id Mailing Lists
      mail.wika.co.id Mailing Lists. Welcome! Below is a listing of all the public mailing lists on mail.wika.co.id. Click on a list name to get more information ...
      mail.wika.co.id/mailman/listinfo - Cached
      wika.co.id - Leading Company - PT Wijaya Karya
      wika.co.id Leading Company - PT Wijaya Karya. ... Report page as adult: Web Stat. Compare wika.co.id to a different website: wika.co.id related sites ...
      twitter-icon.com/site/wika.co.id/ - Cached
      WIKA e-Procurement System
       - [ Translate this page ]
      eproc.wika.co.id/ - Cached - Similar
      PT. Wijaya karya ( persero) tbk - Indonesia
      http://www-wika-co-id.itrademarket.com. Established on March 11, 1960, PT Wijaya Karya ( Limited) , or commonly named WIKA, one of the state owned ...
      www-wika-co-id.itrademarket.com/ - Cached
  15. [PPT]
       - [ Translate this page ]
      File Format: Microsoft Powerpoint - View as HTML
      FINANCIAL MANAGEMENT for NON-FINANCE MANAGER. Disampaikan oleh: B.P. Kusumo Bintoro. (bbintoro_id@yahoo.com). FUNGSI MANAJEMEN KEUANGAN. Disampaikan oleh: ...
  16. [XLS]
      eureka_page4fc670501.. - Leading Company - PT Wijaya Karya
       - [ Translate this page ]
      File Format: Microsoft Excel - View as HTML
      [WLC] Wika Learning Center
       - [ Translate this page ]
      22 Sep 2010 ... Selamat Datang di WIKA LEARNING CENTER - Selamat Datang di WIKA LEARNING CENTER - Selamat Datang di WIKA LEARNING CENTER - Selamat Datang di ...
      learningcenter.wika.co.id/ - Cached
  18. [XLS]
      Milestone Schedule A.. - Leading Company - PT Wijaya Karya
       - [ Translate this page ]
      File Format: Microsoft Excel - View as HTML
      Rekrutmen & Pengembangan Labour Wika - Wika.co.id
       - [ Translate this page ]
      Selamat Datang di WIKA LEARNING CENTER - Selamat Datang di WIKA LEARNING CENTER - Selamat Datang di WIKA LEARNING CENTER - Selamat Datang di WIKA LEARNING ...
      learningcenter.wika.co.id/?uri=frontend&ffunct=odcDetail&id... - Cached
      Show more results from learningcenter.wika.co.id
       - [ Translate this page ]
      Wika.co.id is a domain controlled by two name servers at net.id. Having a total of four IP numbers. Some of them are on the same IP network. ...
      companydatabase.org/kw/www.wika.co.id - Cached
       - [ Translate this page ]
      Wika.co.id is a domain controlled by two name servers at net.id. ... Incoming mail for wika.co.id is ... tokogunungagung.com · tommyalbum.com · trabas.co.id ...
      companydatabase.org/search.php?st=www...co.id - Cached
      wika.co.id - SEODigger report for domain
       - [ Translate this page ]
      wijaya karya, 1, 1 183, 0.05, wika.co.id/, 66.99, 66.99, 1.59, 326 000 ... Competitors in organic search for wika.co.id. - 10 of 200 ...
      www.seodigger.com/wika.co.id - Cached
       - [ Translate this page ]
      Laporan Bulanan Dari Proyek, Divisi, dan Anak Perusahaan dikirim melalui Sistem Informasi Evaluasi Hasil Usaha, tidak melalui media yang lain. ...
      simhu.wika.co.id/proyek/default.htm - Cached
      Index of /htmlarea/images
       - [ Translate this page ]
      Index of /htmlarea/images. Icon Name Last modified Size Description. [DIR] Parent Directory - [IMG] ed_about.gif 24-Feb-2010 14:30 87 [IMG] ...
      simhu.wika.co.id/htmlarea/images/ - Cached
      SIM Hasil Usaha --PROYEK--
       - [ Translate this page ]
      Data maksimal dikirim pada tanggal 5. Jika tanggal 5 jatuh pada hari minggu atau hari libur nasional, maka batas waktu autorisasi diundur menjadi tanggal 6. ...
      simhu.wika.co.id/proyek/Logout.php - Cached
      Wika.co.id | Info Lowongan Kerja Terbaru Perusahaan
       - [ Translate this page ]
      Artikel wika.co.id. ... Search Result From Search Engine "wika.co.id" ... http://www.wika.co.id/ .... The donation distribution was ...
      lowongankerjamu.info/search/wika.co.id - Cached
      Jobs, Career, Vacancy, Lowongan at PT Wijaya Karya (Persero ...
       - [ Translate this page ]
      26 Jul 2010 ... via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. « PT. Kimberly-Clark Indonesia - Electrician ...
      www.info-karir.com/.../jobs-lowongan-kerja-career-pt-wijaya-karya-persero-finance-staff/ - Cached
      Portal.Wika.co.id | Sandhi Firmadani
      Wika.co.id. Official project that firstly goes procedural which i done, Wika's Portal is a web based application which mainly for communcation purposes and ...
      www.firmadani.com/project/wika?page=2 - Cached
      Jasa Keuangan, Jasa Konstruksi
       - [ Translate this page ]
      26 Jul 2010... mail.hutama-karya.com 1 PT Wijaya Karya http://www.wika.co.id/ Jasa Konstruksi mail.wika.co.id 3 PT Virama Karya Konsultan Konstruksi PT ...
      www.docstoc.com/docs/.../Jasa-Keuangan-Jasa-Konstruksi - Cached
      Keputusan Direksi Pt Persero Pelabuhan Indonesia | PDFGirl | PDF ...
       - [ Translate this page ]
      ... PT. ... sebagai berikut : Berdasarkan Surat Keputusan Direksi ... http://www.wika.co.id/data/specialfeatures/LAPKEU%20PT%20WIKA%20SEPT%202009.pdf ...
      www.pdfchaser.com/.../keputusan-direksi-pt-persero-pelabuhan-indonesia.html - Cached
      Download Powerpoint learningcenter.wika.co.id
       - [ Translate this page ]
      Download Powerpoint learningcenter.wika.co.id. ... learningcenter.wika.co.id. Click on me to change image. Please enter the number in the image above ...
      www.findtoyou.com/.../download-proyek+konstruksi-537765.html - Indonesia - Cached
  32. [PDF]
      EIBD Conference, November 28 – 30, 2010 Jakarta, Indonesia ...
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      www.wika.co.id. Construction. PT Hutama Karya www.hutama-karya.com. Construction. PT Lippo Karawaci Tbk www.lippokarawaci.co.id. Property development ...
      wikakaltim : Messages : 4-33 of 33
       - [ Translate this page ]
      AMINUDIN AZIS, ST Engineering Dept. PT. WIJAYA KARYA (Persero) Tbk. Special Area and Overseas Dept. Area VII - KALTIM KALBAR http://www.wika.co.id/ .. ...
      finance.dir.groups.yahoo.com/group/wikakaltim/messages - Cached
      Print Page - PT Wijaya Karya
       - [ Translate this page ]
      Situs Web Perusahaan: http://www.wika.co.id. Informasi Lowongan ... suli@wika.co.id. Biro Perencanaan dan Pengembangan SDM PT Wijaya Karya ...
      www.upiyptk.org/forum/index.php?action=printpage;topic=522... - Cached
      Adk.co.id: Aneka Duta Kreasi : Arts, Crafts & Indonesian Furniture
       - [ Translate this page ]
      6 Agu 2009 ... Related Sites: Kawanlama.com , Indoneem.com , Aristirta.com , Aggio.com , Dino.co.id , Tropika-rattan.co.id , Wika.co.id , Megasetia.com ...
      dawhois.com/site/adk.co.id.html - Cached
      Www Cpns Depag Co Id
       - [ Translate this page ]
      Download your favorite prediksi soal cpns depag 2009 at Pdfdatabase ... http://www.wika.co.id/.../download/WIKA_0710_01_KoJ_Wika . ...
      Soal Ujian Guru Smp Co Id
       - [ Translate this page ]
      http://www.wika.co.id/.../download/WIKA ... uan sma ipa 2010 » prediksi soal soal ujian nasional 2010 sma » prediksi soal soal uasbn sd 2010 » prediksi soal ...
      lowongankerjamu.com/dir/soal+ujian+guru+smp+co+id - Cached
      [parentsguide] Fw: Penawaran Pikacinta [7 Attachments]
       - [ Translate this page ]
      21 Jan 2010 ... wika.co.id>; <ul...@wika.co.id>; <nuning.fitri...@wika.co.id>; <da. ... wika.co.id> Subject: Penawaran Pikacinta Dear Value Customer, ...
      www.mail-archive.com/parentsguide@yahoogroups.../msg22125.html - Cached
      Re: [bonsi97] Jual honda ferio
       - [ Translate this page ]
      wika. co.id <tau...@wika. co.id> Subject: Re: [bonsi97] Jual honda ferio To: ... wika. co.id> To: <bons...@yahoogroups .com> Sent: Tuesday, ...
      www.mail-archive.com/...com/msg02362.html - Cached - Similar
  40. [DOC]
       - [ Translate this page ]
      File Format: Microsoft Word - View as HTML
      nariman@wika.co.id. 0811-3213-28. 031-5994-380 begin_of_the_skype_highlighting              031-5994-380      end_of_the_skype_highlighting. nevo. neputra@chevron.com ... wawan.s@wika.co.id. 0813-1586-0004. 021-8370-8416. wawan sugiarto ...
      List of results for: `gaji wika`. Download and read the most ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA_0901_TJP_WIKA Signs Contract to Build Rp 225 Billion Dam in Batam.pdf. Tags: WIKA , 0901 , TJP , WIKA , Signs ...
      www.hqpdf.com/list/key+gaji+wika - Cached
      Ke Bisnis Batu Bara pdf documents | ebooks library download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/I... Preview pdf of Microsoft PowerPoint - Investor Day 11 Mei ver 5.0 (FINAL .. Microsoft PowerPoint - Investor Day 11 ...
      www.ebooklibs.com/ke_bisnis_batu_bara.html - Cached
      Laporan Keseluruhan Keuangan Perusahaan Tahun 2010 | Pdf Search ...
       - [ Translate this page ]
      ... AND ITS SUBSIDIARIES CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN ... http://www.wika.co.id/data/specialfeatures/Lap%20Keuangan%20Q4%202009.pdf ...
      www.pdf-searcher.com/.../laporan-keseluruhan-keuangan-perusahaan-tahun-2010.html - Cached
      List of sites similar to Waskita.co.id
       - [ Translate this page ]
      11 Okt 2010 ... Screen shot of wika.co.id 6. WIKA (Wika.co.id, similar sites) Title: Wika Ranking: Wika is the world's 827790:th largest site (Alexa) ...
      similarurls.com/waskita.co.id - Cached
      Nama Perusahaan , Banyak tapi Belum Lengkap | Suleymanli Real Estate
       - [ Translate this page ]
      392 WIKA Wijaya Karya Tbk http://www.wika.co.id 6 ADHI Adhi Karya (Persero) Tbk http://www.adhi.co.id/ 204 KARK Dayaindo Resources International Tbk ...
      www.suleymanli.net/.../nama-perusahaan-banyak-tapi-belum_01.html - United States - Cached
      www togelsingapura co id « Berita Sepak Bola
       - [ Translate this page ]
      1 Okt 2010 ... Download your favorite prediksi togel singapore ... http://www.wika.co.id/.../download/WIKA_0710_01_KoJ_Wika Prediksi Lampaui Target..pdf ...
      www.wartabola.com/baca-juga/www-togelsingapura-co-id - Cached
      Kalsel Prov Co Id
       - [ Translate this page ]
      profil/prov kalsel 2006.pdf ... http://www.wika.co.id/.../download/WIKA_PressReleasePLTU_Kalsel_1%5B1%5D[1].1%20ENG.doc ORIG FILE.doc--WITH . ...
      www.informasikarir.com/var/kalsel+prov+co+id - Cached
      Telecharger syariah BNI laporan keuangan 2009 PDF - Pdf gratuit
       - [ Translate this page ]
      Archive: http://www.wika.co.id/data/specialfeatures/LAPKEU%20PT%20WIKA%20SEPT%202009.pdf 30 September 2009 dan 2008.4. Laporan Arus Kas untuk tahun-tahun ...
      www.articlesgt.com/pdf-syariah-BNI-laporan-keuangan-2009/ - Cached
      Wika Co Id
       - [ Translate this page ]
      Baca Selengkapnya Tentang Wika Co Id di Pekerjaanterbaru.com.
  50. [XLS]
      bumn-indonesia.xls - KAMBING.ui.ac.id
       - [ Translate this page ]
      File Format: Microsoft Excel - View as HTML
      29, PT Wijaya Karya, Jasa Konstruksi, http://www.wika.co.id/, mail.wika.co.id, 3. 30, PT Virama Karya, Konsultan Konstruksi ...
      Pupuk-kujang.co.id Site Info
      wika.co.id. 9. petrokimia-gresik.com. 10. badaklng.co.id. Sites with similar names to pupuk-kujang.co.id: 1. pupukids.com. 2. pupua.com. 3. pupuweb.com. 4. ...
      www.alexa.com/siteinfo/pupuk-kujang.co.id - Cached
      Rapat+perusahaan | LombaLomba.com
       - [ Translate this page ]
      11 Apr 2010 ... Link:http://www.wika.co.id/data/download/WIKA%20Financial%20Statement%20September%202008,%20Unaudited.pdf ...
      www.lombalomba.com/?s=rapat+perusahaan - Cached
      Ex-DKI WIKA Community - Events
       - [ Translate this page ]
      ... "budi cahyadi ex wika dki" <budi@... com>, "m chamim" <chamim@... co.id>, "edison" <edisontwp@... com>, "hendra jayusman" <hendra.jayusman@ wika.co.id>, ...
      ex-dki-wika.grouply.com/events - Cached
      Resume - Project Management. Scheduling, Ms.Project, Primavera ...
      Company: WIKA www.wika.co.id. Project: Bidding for High Building Casablanca Mansion Apartment Position: Temporary QS Staff Summary: ...
      Free download pdf: laporan laba rugi dan neraca keuangan PT Bukaka ...
       - [ Translate this page ]
      Laporan keuangan konsolidasian disusun dengan ... Keuntungan dan kerugian kurs yang timbul dibebankan dalam laporan laba rugi konsolidasi ... www.wika.co.id ...
      www.2dix.com/.../laporan-laba-rugi-dan-neraca-keuangan-pt-bukaka-teknik-utama-pdf.php - Cached
      Usage Statistics for aces.co.id - September 2010
      23, 7, 1.31%, 3, 1.39%, 20, 0.81%, 1, 0.70%, smtp.wika.co.id. 24, 6, 1.13%, 1, 0.46%, 19, 0.73%, 1, 0.70%, ...
      www.aces.co.id/webalizer/usage_201009.html - Cached
      Lowongan Kerja PT Wijaya Karya (Persero) | Info aneka lowongan ...
       - [ Translate this page ]
      28 Jul 2010 ... Send your application before July 30, 2010 to. PT Wijaya Karya Persero up Koordinator Keuangan dan Akuntansi. novita@wika.co.id ...
      www.anekalowongan.com/lowongan-kerja-pt-wijaya-karya-persero.html - Indonesia - Cached
  58. [PDF]
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      30 Des 2008 ... Email. imam.s@wika.co.id. HP:08111776000. AFN. Ph. 6221-5290 4028-29. Faks. 6221-5290 4030. Rosalie S. Ticman. 0811926994. Meidy Ahmad ...
      Laporan Keuangan Perusahaan Tahun 2010 .pdf Download
       - [ Translate this page ]
      Neraca untuk tahun-tahun yang berakhir pada tanggal. 31 Maret 2010 dan 2009 ... http://www.wika.co.id/data/specialfeatures/WIKA KONSOLIDASI - MARET 2010.pdf ...
      www.pdfph.com/pdf/laporan-keuangan-perusahaan-tahun-2010/ - Cached
      contoh prospektus perusahaan tbk tahun 2009 PDF
       - [ Translate this page ]
      dari perusahaan Tertutup menjadi Perseroan Terbuka namun penetapannya akan ... http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      pdf.hulufile.com/contoh-prospektus-perusahaan-tbk-tahun-2009.html - Cached
      kurnia salim - free people search
       - [ Translate this page ]
      2 Jul 2010 ... Hong Kong. Kim Eng Securities (HK) Ltd ... http://www.wika.co.id/data/download/Kim%2520eng%25209%2520July%25202009.pdf ...
      hutang dan piutang lancar pdf no
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Laporan%20Keuangan%20Konsolidasi%2031%20Des%2008%20Audited%20+%20Catatan%20atas%20Laporan%20Keuangan%20-%20PT%20Wijaya% ...
      www.96147.com/no/hutang%20dan%20piutang%20lancar.html - Cached
      Detail Archive - Wika.co.id
       - [ Translate this page ]
      3 Sep 2010 ... Creator : Arifin Fahmi; Article Id : 12. Tanggal : 30 Agustus 2010. Topik : [Assignment-md-2010] Sharing Procurement Isi mail: ...
      milist-md.wika.co.id/Finalmilist/detail.php?page=12 - Cached
      laporan neraca bank btpn 31 desember 2009 pdf books Download
       - [ Translate this page ]
      31 Des 2009 ... http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf. mdkey: cfa609ba56f4a336ad2b2b1f0f703573. TAG wijaya karya telah dari hasil ...
      www.edu-doc.com/.../laporan-neraca-bank-btpn-31-desember-2009.html - Cached
      to download a list of importers - For details of suppliers ...
      ... mfapbrian@sbcglobal.net meyerlab@pla.net.py metro2@vsnl.com metro@spctnet.com metalurgica@metalurgicalavin.cl metal@wika.co.id metal@qualitynet.net ...
      www.seeksuppliers.net/importeremail.csv - Cached - Similar
      info kantor2 arsitek (Page 1) - Bebas Bicara - ARCHITERIAN FORUM
       - [ Translate this page ]
      4 posts - 4 authors - Last post: 23 Jan
      EMAIL : adwijaya@wika.co.id. WASTU CITRA BIRO ARSITEK. JALAN BOROBUDUR 16 LT.2 MALANG, JAWA TIMUR. TELP : 0341 – 418 773 begin_of_the_skype_highlighting              0341 – 418 773      end_of_the_skype_highlighting ...
      www.architerian.net/myforum/viewtopic.php?id=4288 - Cached - Similar
      Get more discussion results
      Ambassade d'Indonésie en Algérie
       - [ Translate this page ]
      Email: adwijaya@wika.co.id. Produits: Construction. 2. PT. DUTA GRAHA INDAH Jl. Sultan Hasanuddin No. 69. Jakarta 12160 – Indonesia Phone: (62-21) 7221003 ...
      www.indonesia-dz.org/exhibitor_FIA%20(french).html - Cached
      THE CONTRIBUTOR: October 2009
       - [ Translate this page ]
      Kepada: corporate-care-7@wika.co.id. Tanggal: Selasa, 1 September, 2009, 6:02 AM Siang Pak Hermawan, Saya pernah denger dari p suardi bahar perihal optimasi ...
      ccp7.blogspot.com/2009_10_01_archive.html - Cached
      analisis faktor faktor yang mempengaruhi profitabilitas pada usaha ...
       - [ Translate this page ]
      11 Okt 2010 ... tag : http://learningcenter.wika.co.id/FILES/eureka_page2f1e0a15815d... [View] server source : learningcenter.wika.co.id ...
      www.linkpdf.com/.../analisis-faktor-faktor-yang-mempengaruhi-profitabilitas-pada-usaha--.ppt - Cached
      wijaya karya - Followtopia
       - [ Translate this page ]
      www.wika.co.id - (Response time: 5.65 seconds) Links to this page: 111 Links to this domain: ... wika.co.id/data/download/WIKA 7 September 2009 ( Pandu An.. ...
      www.followtopia.com/index.php?query=wijaya%20karya - Cached
      Yenwy Wongso - Pipl Profiles
       - [ Translate this page ]
      [ www.wika.co.id ]. WIKA,Equity,co.id,IPO,y-o-y,Bahana Securities,Wijaya ... [ www.wika.co.id ]. congestion,Tanjung Priok,government,containers,congestion ...
      pipl.com/directory/name/Wongso/Yenwy - United States
      laporan keuangan bank bri 2009 – PDFs Search engine.
       - [ Translate this page ]
      Bank Mega Tbk. 1110887823 ... http://www.wika.co.id/data/download/LAPKEU MARET 2009 - REVISED.pdf. Laporan Keuangan Konsolidasian (Unaudited) Q2 2009 ...
      proxy.caw2.com/index.php?vit=uggc%3A%2F%2Fjjj.cqsf...oev... - Cached
      AKTIVA LANCAR | PDF Finder | PDF Search Engine
       - [ Translate this page ]
      ... Kas dan Setara Kas 133376232451 101584844251 Pinjaman Jangka Pendek ... http://www.wika.co.id/data/specialfeatures/laporan%20konsolidasian%20Q3.pdf ...
      www.pdf-finder.com/pdf/AKTIVA-LANCAR.html - Cached
      Lowongan Staf Keuangan PT Wijaya Karya (Exp: 30 Juli 2010 ...
       - [ Translate this page ]
      30 Jul 2010 ... kirim ke: pramusinto@wika.co.id atau novita@wika.co.id. Info Selengkapnya di : SARIKERJA. Related Posts. LOWONGAN KERJA TERBARU PT WIJAYA ...
      pltu pln pdf - Sz Web Search
       - [ Translate this page ]
      ... Proyek PLTU Kalimantan Selatan senilai total Rp 1,2 Trilliun milik PT PLN ... http://wika.co.id/data/download/WIKA_PressRelease_GroundBreaking_ver.1.5. ...
      www.sz-pet.com/pltu-pln-pdf.html - United States - Cached
  76. [PDF]
      Pil Award 2009
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      Website, www.wika.co.id. Bidang Usaha : Jasa Konstruksi .... Email: ronnysusanto@wika.co.id. Lulusan Sarjana Teknik Sipil Universitas Gajah ...
      INDONESIA - The Refineries. - Free Online Library - www.bobbang.com
       - [ Translate this page ]
      ... IPP Geothermal Electricity Generator 50 MW, PLTU Asam- Asam 2x65 MW South Kalimantan PLTU Cilacap 2x300 MW, Jawa Tengah 2x300 MW. www.wika.co.id ...
      Wika Bandar Lampung - Petrochemical Oil Jobs
       - [ Translate this page ]
      Source :http://www.wika.co.id/data/download/WIKA_PresRelease_SiteVisitWIKABeton_ver.2.0_ENG_Final.pdf. LC Eska. LC is the LARGEST Indonesian ...
      www.petrochemicaloiljobs.com/jobsearch/wika+bandar+lampung - Cached
      akden_wika : Message: Bls: Bls: [akden_wika] Droping Minggu II ...
       - [ Translate this page ]
      6 posts - 2 authors - Last post: 17 Jun
      If you need Clarification or have received this communication error please notify us immediately by responding to adwijaya@wika. co.id ...
      groups.yahoo.com/group/akden_wika/message/223 - Cached
      Get more discussion results
      [HELP]kapan kontraktor2 mulai ISO 9001:2000 (butuh infonya ...
       - [ Translate this page ]
      wika.co.id/ina/invesrel/index.php?act=detailnews&p_id=128 >- wika.co.id/ina/invesrel/index.php?act=detailnews&p_id=163 ...
      archive.kaskus.us/.../helpkapan-kontraktor2-mulai-iso-90012000-butuh-infonya-mendesak - Cached
      karya - eBook Downloads
       - [ Translate this page ]
      www.wika.co.id/data/download/WIKA%20-%20The%20infrastructure%20play,%20initiate%20with... - View · Towards the Consolidation Year ...
      pdfcatch.net/ebook/karya/ - Cached
      Indopremiersecurities Pt Wijaya Karya Tbk - Low Diet Online
       - [ Translate this page ]
      Source: http://www.wika.co.id/data/download/SN_WIKA_20090812%2520(A.G%2520Pahlevi%2520-%2520IndoPremier%2520Securities).pdf ...
      www.lowdietonline.com/.../indopremiersecurities+pt+wijaya+karya+tbk - United States - Cached
      hubungan kesehatan anak pdf downloads
       - [ Translate this page ]
      ( http://www.wika.co.id ); Bab 7.9: Hak Ekonomi dan Sosial; kebutuhan dasar pembelajaran membatasi perkembangan anak-anak dan peluang masa depan. ...
      www.pdfgeni.org/.../hubungan-kesehatan-anak-pdf.html - United States - Cached
      Mailto - download free online
      ... advisind@indosat.net.id, advokasi@indosat.net.id, adw@centrin.net.id, adwijaya@wika.co.id, adwin@bintangdelapan.com, adwitiya@indosat.net.id, ...
      www.scribd.com/doc/6624831/Mailto - Cached - Similar
      LAPORAN BETON 2008 | Kompak
       - [ Translate this page ]
      http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ... http://www.wika.co.id/data/specialfeatures/Lap%20Keuangan%20Q4%202009.pdf ...
      www.kompak.org/LAPORAN-BETON-2008.html - Cached
      Fw: [sma37_91] FW: Arogansi si Evan Brimob - Milis Perumahan Pirus ...
       - [ Translate this page ]
      wika.co.id>; Rudy Novira MM Ext <rudy.nov...@gmail.com>; Rozi Rinjayadi HK <rinjay...@gmail.com>; romansa9...@yahoo.com; roe salam <roe_sa. ...
      groups.google.com.my/group/pirus/msg/2d09a19baba9ae7c - Cached
      KALEIDOSKOP 2009 KEGIATAN MENTERI PU - www.sinzub.com
       - [ Translate this page ]
      www.wika.co.id. SUARA MERDEKA - NASIONAL. Bengawan Solo Akan Ditanggul 4 Meter. JAKARTA- Departemen Pekerjaan Umum merencanakan Balai Besar Wilayah Sungai ...
      Pt-nindya-karya | Info Musik
       - [ Translate this page ]
      ... PT Hutama Karya, PT Nindya Karya, PT Pembangunan Perumahan and PT Waskita Karya ... http://www.wika.co.id/eng/sbu/?act=mechanical_ref ...
      news.bandungkaos.com/information/pt-nindya-karya - Cached
      Squid Analysis Report Generator Squid User Access Report Period ...
       - [ Translate this page ]
      www.wika.co.id, 12/19/2007, 11:21:59. www.wika.co.id, 12/19/2007, 11:22:04. www.wika.co.id, 12/19/2007, 11:22:35. www.wika.co.id, 12/19/2007, 11:22:40 ...
      www.uptp2b.uns.ac.id/.../tt10.86.49.182-www_wika_co_id.html - Cached
      Data Emiten
       - [ Translate this page ]
      Website, www.wika.co.id. Listing Date, 29 Oktober 2007. Board, Utama ... Natal Argawan Pardede, S.E, natal.argawan@wika.co.id, +6221-8192808 begin_of_the_skype_highlighting              +6221-8192808      end_of_the_skype_highlighting, 8508640, ...
      www.dwac-ca.com/dwac/index.php?option...id - Cached
      Wijaya Karya - Wikipedia bahasa Indonesia, ensiklopedia bebas
       - [ Translate this page ]
      ... (2001)Rp 26 milyar; (2002)Rp 30 milyar; (2003)Rp 46 milyar; (2004)Rp 96 milyar; (2005)Rp 96 milyar. Karyawan, 1000. Situs web · http://www.wika.co.id/ ...
      id.wikipedia.org/wiki/Wijaya_Karya - Cached - Similar
      Pt Bina Santika Wijaya - People / info about name Pt Bina Santika ...
       - [ Translate this page ]
      About PT Wijaya Karya (wika.co.id): A state-owned enterprise involved in construction, manufacturing, trade and realty. Descriptions … www.alexa.com ...
      www.yasni.com/pt+bina+santika+wijaya/check+people - United States
      PT NINDYA KARYA (PERSERO) - Your Amazing Partner 4 Construction ...
       - [ Translate this page ]
      Convertible Bond. Rp 218,5 M. Share Equity. Rp 87,5 M. PT KARYA (Persero) Tbk. 30. DIVISI BANGUNAN GEDUNG. PT WIJAYA KARYA – 99. www.wika.co.id ...
      revaluasi aktiva tetap PDF Download
       - [ Translate this page ]
      384/KMK.04/1998 tanggal 14 Agustus ... http://www.wika.co.id/data/download/LAPKEU%20MARET%202009%20-%20REVISED.pdf. Laporan Keuangan Financial ReportShow ...
      www.book925.com/revaluasi-aktiva-tetap-pdf.html - Cached
      grandtugumudatours.blogspot.com - www.aseanmusic.com
       - [ Translate this page ]
      6. 1 Januari 2011. 08.00 – Selesai. Pelantikan Pegawai PT Wijaya. Karya (Persero) Tbk. Gedung WIKA. www.wika.co.id. Menanti Direksi Baru Pertamina ...
      proyek jorr w1 pdf search no 1 pdf-doc
       - [ Translate this page ]
      10 Tol Surabaya Mojokerto 37** 1432 0% - Civil Contr. 11 JORR W1 9** 311 0 ... http://www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf ...
      www.pdf-doc.net/no/proyek%20jorr%20w1-pdf-1.html - Cached
      Jakarta Raya :: Jakarta Barat :: Puri Kembangan
       - [ Translate this page ]
      http://www.wika.co.id/data/download/wika%20113009%20(%20Maxi... NAMA DAN ALAMAT TAMAN KANAK-KANAK (TK) NEGERI DAN SWASTA DI ... Puri Kembangan Barat Raya. ...
      unjobs.org/duty_stations/indonesia/.../puri-kembangan - Cached - Similar
      Civil UNAND | Facebook
       - [ Translate this page ]
      silahkan mengirimkan lamaran ke WIKA via email : puspa@wika.co.id. Yang dibutuhkan : ... S1 Teknik (Mesin/Elektro/Fisika/Sipil) ...
      www.facebook.com/group.php?v=wall&gid=55511625744 - Cached
      WWW HASIL UNAS SD CO ID | for Share
       - [ Translate this page ]
      http://www.wika.co.id/.../download/WIKA_0710_01_KoJ_Wika ... http://www.dikdasdki.go.id/.../kebijakan/juknis_unas_sd ... unas smp sidoarjo » mendiknas unas ...
      muniri.com/.../WWW%2BHASIL%2BUNAS%2BSD%2BCO%2BID - Indonesia - Cached
      Laporan Keuangan Tahun 2009 - Rachimuddin dot com
       - [ Translate this page ]
      ... Neraca untuk tahun-tahun yang berakhir pada tanggal 30 Juni 2009 dan 2008 ... From: http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      www.rachimuddin.com/.../laporan+keuangan+tahun+2009.html - Indonesia - Cached

    * Everything

    * Images
    * Videos
    * News
    * Books
    * Places
    * Blogs
    * Updates
    * Discussions


    * Kuala Lumpur, Federal Territory of Kuala Lumpur

    * Auto-detected

Change locationClose
Search Options

      Search settings | Sign in
Advanced search
Page 2 of about 29,400 results (0.12 seconds) 
Search Results

      Bumblebee Cakery » Pricelist - www.cuntud.com
       - [ Translate this page ]
      www.wika.co.id. Winrar 3.90 Full Version « ITclub's Blog. Apalagi sekarang anda bisa mendownload yang Full Version, karena kalau anda ikhlas membelinya ...
      "Before You Demand, We Already There." - eBizzAsia Februari - www ...
       - [ Translate this page ]
      30 Sep 2010 ... www.wika.co.id. Hanura Duga BI Salahgunakan Kewenangan - INILAH.COM. Sebenarnya, menurut dia, merger dan akuisi sebenarnya tidak ada jika BI ...
      Lowongan PHP dan VB di PT. Wijaya Karya » bursa-kerja.net
       - [ Translate this page ]
      23 Agu 2010 ... Silahkan kirim CV anda ke email beben@wika.co.id untuk selanjutnya mendapatkan jadwal interview dan tes keahlian aplikasi. ...
      www.bursa-kerja.net/.../lowongan-php-dan-vb-di-pt-wijaya-karya.html - Cached
      Fw: [!! SPAM] Fw: Fwd: Bantuan - graduate-lp3i | Grup Google
       - [ Translate this page ]
      18 Feb 2009 ... wika.co.id>; Pak Bahar Pusat <bedo...@yahoo.com>; Pak bakri wika <bakr. ... wika.co.id>; mbak ririn dsu1 <ririn...@yahoo.com>; M'DIAN DEPT ...
      groups.google.co.id/group/graduate-lp3i/msg/0a8cd3dc4ca10daa - Cached
      Registrasi - WIKA e-Procurement System
       - [ Translate this page ]
      CV, Ltd, Firma, NV, Perum, PT. : : : Aceh, Bali, Bangka-Belitung, Banten, Bengkulu, D I Y, D K I, Gorontalo, Jambi, Jawa Barat, Jawa Tengah, Jawa Timur ...
      eproc.wika.co.id/indonesia/registrasi.php - Cached - Similar
      WIKA e-Procurement System
       - [ Translate this page ]
      Kebijakan Wika dalam pengadaan barang/jasa lebih memprioritaskan pengadaan secara langsung dari pabrikan, distributor resmi atau agen tunggal dan ...
      eproc.wika.co.id/indonesia/kebijakan.php - Cached
      Psak Nomor 59 | Pdf Search Engine Free Ebooks
       - [ Translate this page ]
      Berdasarkan Akta No. 59 tanggal 23 Mei 2008 mengenai ... http://www.wika.co.id/data/specialfeatures/WIKA%20KONSOLIDASI%20-%20MARET%202010.pdf ...
      www.pdf-searcher.com/pdf/psak-nomor-59.html - Cached
      Retensi Pelanggan | Pdf Search Engine Free Ebooks
       - [ Translate this page ]
      ... ARUS KAS DARI AKTIVITAS OPERASI Penerimaan Kas dari Pelanggan 4.585.214 ... http://www.wika.co.id/data/specialfeatures/LAPORAN%20WIKA%20DES%202007.pdf ...
      www.pdf-searcher.com/pdf/retensi-pelanggan.html - Cached
      e-ketawa :-) Trs: Rahasia Sukses....
       - [ Translate this page ]
      19 Jun 2009 ... wika..co.id>; santi <suntea_novia@ yahoo.com>; Primatexco-Ary <ari.june@gmail. com>; Primatexco-Ganjar <gn_plus@yahoo. co.id>; Popi Dian ...
      www.opensubscriber.com/message/e...com/12457365.html - Cached - Similar
      balirage.blogspot.com - www.dosiwa.com
       - [ Translate this page ]
      Wika.co.id. Laporan arus kas konsolidasian untuk aktivitas operasi disusun dasar aktivitas operasi, ... The Consolidated statement of cash. www.wika.co.id ...
      Bni securities Tips for ... | Tips-Search.com
       - [ Translate this page ]
      http://www.wika.co.id/data/download/wika%20113009%20(%20Maxi%20-%20BNI%20Securities).pdf. Burlington Northern Sante Fe (BNI) | Dividend Stock Profile . ...
      tips-search.com/c/.../tag/bni+securities+ - Cached
      IP 1661 3583 689 339046 1024 0 1443 http://piwik.org/faq/general ...
      ... 0 4 http://www.wika.co.id/ Indosatm2 7 21 19 2443 3 0 6 http://www.indosatm2.com/ Solonet 7 10 8 169 6 0 7 http://www.solonet.co.id/ Panasonic 6 9 9 241 ...
      pregool.com/piwik/?module=API&method...1... - Cached
      โหลดเพลง แค...Fproc/self/environ /index.php?option ...
       - [ Translate this page ]
      Fproc/self/environ /index.php?option=com_myblogcontroller=http://simhu.wika.co.id/simpak_603/subframe/gambar/kodok/ahai/fx29id1.txt??.mp3 โหลดเพลงแค.
      mp3zeed.com/mp3/index.php?search...wika.co.id%2Fsimpak... - Cached
      Year 2009 In Pelabuhan Ratu pdf documents | ebooks library download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/W... Preview pdf of Microsoft Word - WIKA CG Q2 2009 ver 2.3 · Microsoft Word - WIKA CG Q2 2009 ver 2.3 free download ...
      www.ebooklibs.com/year_2009_in_pelabuhan_ratu.html - Cached
      Lowongan Kerja PT. Wijaya Karya (WIKA) « IT SHARED
       - [ Translate this page ]
      25 Jul 2010 ... Wijaya Karya (persero), Tbk., Departemen Energi, Up. Koordinator Keuangan dan Akuntansi, via Email ke alamat berikut: pramusinto@wika.co.id; ...
      blogneea.wordpress.com/.../lowongan-kerja-pt-wijaya-karya-wika/ - Cached
      PT Indosiar Karya Media - Jakarta Indonesia - Company - www.dumdin.com
       - [ Translate this page ]
      19 Jan 2010... PT Wijaya Karya Beton (WIKA Beton) PT Wijaya Karya (WIKA) on Thursday, 28 June 2007 in WIKA's head office, Jakarta. www.wika.co.id ...
      Leading+company+pt+wijaya+karya | Kumpulan Tips Pilihan
       - [ Translate this page ]
      wika.co.id Leading Company - PT Wijaya Karya edit. international leading company in construction, perusahaan (source) ...
      tipsoke.com/tag/leading+company+pt+wijaya+karya - Cached
      Laporan Tahunan Bapepam Tahun 2002 PDF @ PDFWindows.Com
       - [ Translate this page ]
      Source: http://www.wika.co.id/data/specialfeatures/CODE%2520OF%2520CORPORATE%2520GOVERNANCE%25202009.pdf. Download 2009 Annual Report Bahasa Version PT ...
      www.pdfwindows.com/.../laporan+tahunan+bapepam+tahun+2002.html - Cached
      pt danpac futures Pdf
       - [ Translate this page ]
      0.05%. 8. PT Dhanawibawa Artha Cemerlang .. launched futures on the Dow Jones Industrial Average and Dow Jones Japan Titans www.wika.co.id - View - Download ...
      bukubaru.net/pt-danpac-futures.html - Cached
       - [ Translate this page ]
      pramusinto@wika.co.id. Atau novita@wika.co.id. Batas pengiriman lamaran paling lambat tanggal 30 Juli 2010. Job Interview Tips Practice ...
      TestCompany mail: [ob] Good website!
       - [ Translate this page ]
      15 Mei 2009 ... Sawedi(*)valeinco.com>, Sonny Setiawan <sonnysetiawan(*)wika.co.id>, Reza Siregar <Muhammad.Siregar(*)sampoerna.com>, Iskandar PTI - SOR ...
      testcompany.com/archive/May2009-19/11550.html - Cached
      laporan keuangan triwulan iii maret 2009 leading company pt pdf ...
       - [ Translate this page ]
      Iktisar Keuangan WIKA untuk Triwulan I-2009 (Unaudited). 2009 1) ... http://www.wika.co.id/data/download/WIKA_Press Release WIKA Q1 2009 ver 2.1.pdf ...
      www.ebookf.com/.../laporan-keuangan-triwulan-iii-maret-2009-leading-company-pt-book.pdf - Cached
      indonesian jobs vacancy
       - [ Translate this page ]
      14 Agu 2010 ... pramusinto@wika.co.id Atau novita@wika.co.id. Posted by Komunitas Blogger Indonesia at 8:25 PM 0 comments · Email This BlogThis! ...
      bursakerja.sman1ngunut.info/ - Cached
      anugrah - Document Search Engine - Rapid4search.com
       - [ Translate this page ]
      Toll road, Automotive, Heavy ... http://www.wika.co.id/data/download/WIKA%207%20September%202009%20(%20Pandu%20Anugrah%20-%20Bahana%20Securities).pdf ...
      docs.rapid4search.com/anugrah/page1/en - Cached
      Attn:Western Union Customer (Reply Now) - spam
       - [ Translate this page ]
      21 Apr 2010 ... If you need Clarification or have received this communication error please notify us immediately by responding to adwijaya@wika.co.id ...
      emailcondom.com/1232 - Cached
      harga tiang pancang - Free Online eBook Collection
       - [ Translate this page ]
      www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf ... market risk premium 6%, terminal growth 3%, dan WACC 15.2%, maka diperoleh target ...
      www.pdftop.com/ebook/harga+tiang+pancang/ - Cached
      Site details: Great Literary Works - Page: 2
      11 Okt 2010 ... rawURL=http%3A%2F%2Fwww.wika.co.id%2Fdata%2Fdownload%2FCLSA%252014%2520Mei%25202008.pdf&0=&1=0&4= ...
      start.facemoods.com/results.php?s...category=web&start=1... - Cached
      TT-Table Kotak info perusahaan
       - [ Translate this page ]
      ... (2000)Rp 18 milyar* (2001)Rp 26 milyar* (2002)Rp 30 milyar* (2003)Rp 46 milyar* (2004)Rp 96 milyar* (2005)Rp 96 milyar, 1000, http://www.wika.co.id/ ...
      toolserver.org/~kolossos/templatetiger/tt-table4.php?... - Cached
      Ikhsan Binarto - People / info about name Ikhsan Binarto - yasni ...
       - [ Translate this page ]
      Ikhsan Binarto, an analyst in PT Optima Securities said that the contracts will have a positive impact on WIKA especially on the revenue … www.wika.co.id ...
      Saham Wika Wijaya Karya Persero Tbk Land place
       - [ Translate this page ]
      D. Dalam hal PT Wijaya Karya (Persero) Tbk ... http://www.wika.co.id/data/specialfeatures/CODE%20OF%20CORPORATE%20GOVERNANCE%202009.pdf ...
      indo.nesiaku.com/story/saham+wika+wijaya+karya+persero+tbk.html - Cached
      Mencari wika di Semua Pilihan - Seluruh Dunia - Semua Hari ...
       - [ Translate this page ]
      PT. REKA CIPTA MANDIRI .... company called PT. WIJAYA KARYA ( Persero) Tbk. ( http: / / wika.co.id) .... Google Talk: karimkailane karimkailane ...
      indonetwork.web.id/alloffers/75/wika.html - Cached
       - [ Translate this page ]
      9 Jakarta 13340 Phone : 021 – 819 2808, 850 8640, 850 8650 Fax : 021 – 819 1235 Email : adwijaya@wika.co.id... PT. Intiland Development Tbk ...
      www.blogcatalog.com/.../company%20address%20%20%20alamat%20perusahaan/ - Similar
      Lowongan Kerja BUMN PT PT Wijaya Karya Terbaru | Lowongan Kerja
       - [ Translate this page ]
      28 Jul 2010 ... Wijaya Karya (Persero), Tbk., Departemen Energi, Up. Koordinator Keuangan & Akuntansi via email ke alamat email: pramusinto@wika.co.id atau ...
      lowongan-kerja.us/lowongan-kerja-bumn-pt-pt-wijaya-karya-terbaru/ - Cached
       - [ Translate this page ]
      Surat Keputusan Direksi No. 01.09/A.DIR 0702 ... http://www.wika.co.id/data/download/WIKA%20Financial%20Statement%20September%202008,%20Unaudited.pdf ...
      www.pdfchaser.com/.../KEPUTUSAN-DIREKSI-PT-(PERSERO)-PELABUHAN-INDONESIA-I.html - Cached
      Situs Jual Beli Kapal Pertama Di Indonesia :: IndonesianShip.com
       - [ Translate this page ]
      Nama : | Email : oong@wika.co.id | Telepon : 0812 8343522 | Fax : Vacancy in Fabrication Yard. Saipem, 43% owned by Eni S.p.A., is organized into three ...
      www.indonesianship.com/CrewsMarket.asp?offset=10 - Cached
      Aktiva Tetap | My PDF Search Engine Free Ebooks
       - [ Translate this page ]
      ... Tanah Belum Dikembangkan Land for Development Aktiva Tetap Fixed ... http://www.wika.co.id/data/specialfeatures/LAPORAN%20WIKA%20DES%202007.pdf ...
      www.mypdfsearchengine.com/pdf/aktiva-tetap.html - Cached
      Lintas Berita - Wika Konstruksi - Pengumuman Peserta Seleksi ...
       - [ Translate this page ]
      Untuk Informasi lebih lanjut, Silahkan ke http://www.wika.co.id/ina/company_info/index.php?act=special_feature. baca selengkapnya. ...
      www.lintasberita.com/.../wika-konstruksi-pengumuman-peserta-seleksi-wawancara-psikologi - Cached
      Kontraktor « Konstruksi dan Pemeliharaan « Bisnis | Daftar Website ...
       - [ Translate this page ]
      PT Wijaya Karya (Persero) Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, Tangerang and Bekasi ... http://www.wika.co.id ...
      daftarweb.org/Bisnis/Konstruksi_dan.../Kontraktor - Indonesia - Cached - Similar
      • Wijaya Karya In Trade Pt • Jakarta • Peralatan rumah, Jasa dan ...
       - [ Translate this page ]
      Wika.co.id - Site Info from Alexa PT Wijaya Karya. About PT Wijaya Karya (wika.co.id): A state-owned enterprise involved in construction, manufacturing, ...
      www.tuugo.net/Companies/wijaya-karya-in...pt.../0160001872299 - Cached
       - [ Translate this page ]
      25 Jul 2010 ... Wijaya Karya (Persero), Tbk., Departemen Energi, Up. Koordinator Keuangan & Akuntansi via email ke alamat berikut ini. pramusinto@wika.co.id ...
      lowongan-kerja1.co.cc/lowongan-kerja-terbaru-pt-wijaya-karya-fresh-graduate-are-welcome-mei-2010-lowongan-pekerjaan-terbaru-2010... - Cached
      PT Wijaya Karya (Persero) - Finance Staff - Bursa Lowongan Kerja ...
       - [ Translate this page ]
      via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. « PT. Kimberly-Clark Indonesia - Electrician ...
      www.zimbio.com/.../PT+Wijaya+Karya+Persero+Finance+Staff - Cached
      Wijaya Karya Beton | Wijaya Karya Beton
       - [ Translate this page ]
      Direktur Alamat Lengkap Jl Bambang Utoyo Rama Kasih Raya 957 - Palembang - Indonesia Telephone 0711-712534. Fax 0711-720093. Website www.wika.co.id. Brosur.
      wkb-palembang.yptrading.co.id/ - Cached
      struktur modal pt jasa marga - Free PDF Resource And Files - on ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Mega%20Capital%20Indonesia%2030%20Juni%202008.pdf. Pendapatan dari jasa konstruksi memberikan kontribusi dari IDR408, ...
      www.dailybust.com/pdf-files/struktur-modal-pt-jasa-marga - Cached
      Berita tentang indopos co id indo pos online | Berita Terkini
       - [ Translate this page ]
      smtp.wika.co.id: 15: 85005: 0.16%: 83481: 0.21% ... jawa pos online: 13: 422: 0.72%: indopos: 14: 409: 0.70%: jawa pos pdf ... jawapos online: 18: 234: ...
      zeuder.co.cc/news/indopos+co+id+indo+pos+online - Cached
      Weston Essential Housewares - www.shopweston.com - administrator
       - [ Translate this page ]
      purwanto, Jl Biru Laut I No 4 Jaktim, 13340, jakarta, purwanto.g@wika.co.id, H: 8192808. M: 085230008221, view detail. RIYA NURFITRIYANNA EKA ATDMAJA, JL. ...
      adm.shopweston.com/shopweston.php?page=visitor...1... - Cached
      World Wide Web Virtual Library: Papua, Indonesia (via PapuaWeb ...
      22 Oct 2005... the assistance of AusAID (working with the Indonesian contractor PT Wijaya Karya at www.wika.co.id), most other towns in Papua continue ...
      www.papuaweb.org/vl/www/04.html - Cached - Similar
      WebMii - Karya Wijaya
       - [ Translate this page ]
      http://www.wika.co.id/data/download/7May09-WIKA,%201Q09%20Profit%20Fueled%20by%20Upbeat%20Margin%20(%20Stanley%20Tjiandra%20-%20Trimegah%20Sec).pdf ...
      www.webmii.es/Result.aspx/Karya/Wijaya - Cached
      Jembatan Rangka Baja pdf document, ebook
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA%207%20September%202009%20(%20Pandu%20Anugrah%20-%20Bahana%20Securities).pdf ...
      ebookpedia.net/ebook/jembatan-rangka-baja.html - United States
      Tempointeraktif.Com - Pemisahan Anak Perusahaan PLN Dibatalkan ...
       - [ Translate this page ]
      Manager di Kamboja • WIKA Peduli Yogyakarta dan Jawa Tengah Knowledge Enterprise Award • WIKA Tawarkan Saham Perusahaan Anak. www.wika.co.id ...
      laporan keuangan 31 desember 2008 syariah mandiri PDF
       - [ Translate this page ]
      31 Des 2008 ... 2751189909. 446296470. PT. Bank Syariah BRI ... http://www.wika.co.id/data/specialfeatures/WIKA%20KONSOLIDASI%20-%20MARET%202010.pdf ...
      pdf.hulufile.com/laporan-keuangan-31-desember-2008-syariah-mandiri-page5.html - Cached
      pt mahkota inti citra pdf search tw 1 docpdf
       - [ Translate this page ]
      PT. 1636207260. 2053728237. Belleza ... http://www.wika.co.id/data/download/WIKA%2520Financial%2520Statement%2520September%25202008,%2520Unaudited.pdf ...
      www.docpdf.org/tw/pt%20mahkota%20inti%20citra-pdf-page1.html - Cached
      nusa wijaya - free people search
       - [ Translate this page ]
      ... the first co-development of building by government and private sector, ... http://www.wika.co.id/eng/invesrel/index.php%3Fact%3Ddetailnews%26p_id%3D45 ...
      laporan neraca bank btpn 31 desember 2009 ebook books Download
       - [ Translate this page ]
      http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf. mdkey: cfa609ba56f4a336ad2b2b1f0f703573. TAG wijaya karya telah dari hasil pt wijaya ...
      www.edu-doc.com/index.php?q=laporan+neraca+bank+btpn... - Cached
      Daftar Link Situs BUMN Indonesia
       - [ Translate this page ]
      16 Des 2009 ... PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi ...
      adegustiann.blogsome.com/.../daftar-link-situs-bumn/ - Indonesia - Cached - Similar
      Free download pdf: CONTOH LAPORAN KEUANGAN PERUSAHAAN tahun 2009
       - [ Translate this page ]
      ... dari laporan keuangan secara keseluruhan ... Perusahaan sd 30 September untuk tahun 2009 dan 2008 adalah sebesar Rp.1.477.833. ... www.wika.co.id ...
      www.2dix.com/.../contoh-laporan-keuangan-perusahaan-tahun-2009-pdf.php - Cached
       - [ Translate this page ]
      ... menghasilkan produk ... persetujuan pada Rapat Dewan Komisaris selambat-lambatnya 60 (enam puluh) hari ... www.wika.co.id | View PDF | Download PDF ...
      www.pdf.kq5.org/search/RAPAT+DEWAN+MANAJEMEN+LABA - Cached
      Direktori Alamat Instansi Non Kementerian Pekerjaan Umum ...
       - [ Translate this page ]
      Jl. D. I. Panjaitan Kav. 9 Jakarta 13340. Telepon. : 021-8192808. Fax. : 021-8191235. Email. : adiwijaya(at)wika.co.id. Website. : http://www.wika.co.id ...
      pustaka.pu.go.id/new/alamat-lain.asp?start=41 - Cached
      METRO TV NEWS - www.wunwan.com
       - [ Translate this page ]
      Tuban Aromatic Plant Gas Power Plant-Tuban, Jatim : Wika-Adhi Grati Combine Cycle Power Plant 6 X 150 MW-Pasuruan West Java. www.wika.co.id ...
      PT Reca Cipta Mandiri Utama - Indonesia - Company Info
      WIJAYA KARYA ( Persero) Tbk. ( http: / / wika.co.id) encompassing function such as venue trading management and finance development. ...
      pt-rcmu.itrademarket.com/profile/pt-reca-cipta-mandiri-utama.htm - Cached
      Partners - www.henjai.com
       - [ Translate this page ]
      28 Jul 2010 ... PT Wijaya Karya Beton (WKB) , merupakan perusahaan yang memproduksi beton pre-cast panel dan. www.wika.co.id ...
       - [ Translate this page ]
      30 Okt 2009 ... Kepada: corporate-care-7@wika.co.id. Tanggal: Selasa, 1 September, 2009, 6:02 AM Siang Pak Hermawan, Saya pernah denger dari p suardi bahar ...
      ccp7.blogspot.com/ - Cached
      Bahana - Pipl Profiles
       - [ Translate this page ]
      [ www.wika.co.id ]. co.id,Cement,Bahana Securities,Indonesia,market share,y-o-y,, Disclosure: Bahana Securities does and seeks to do business ...
      pipl.com/directory/name/Bahana - United States
      pltu pln pdf pdf no
       - [ Translate this page ]
      Perusahaan Listrik Negara (PLN ... http://www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf. PT. INDO MULTI KARYA ...
      www.96147.com/no/pltu%20pln%20pdf.html - Cached
      Search email di google (lihat penjelasan di email) keyword: "nama ...
       - [ Translate this page ]
      ... waterbom-jakarta.com watytjakra.com web.de webcenter.co.id websquash-marketing.com wedrybest.com wika.co.id wintermar.com wiratman.co.id wireless.co.id ...
      www.bisnis5milyar.com/.../Keyword%20Google.txt - Indonesia - Cached - Similar
      Lowongan Staf Keuangan Pt Wijaya Karya Exp 30 Juli 2010
       - [ Translate this page ]
      Wijaya Karya (Persero), Tbk., Departemen Energi, Up. Koordinator Keuangan & Akuntansi via email ke alamat berikut ini. pramusinto@wika.co.id ...
      commentportal.com/.../lowongan-staf-keuangan-pt-wijaya-karya-exp-30-juli-2010 - Cached
      pltu pln pdf - Sz Web Search
       - [ Translate this page ]
      ... PLTU Kalimantan Selatan senilai total Rp 1,2 Trilliun milik PT PLN ... http://www.wika.co.id/data/download/WIKA_PressRelease_GroundBreaking_ver.1.5. ...
      www.sz-pet.com/pltu%20pln%20pdf.html - United States - Cached
       - [ Translate this page ]
      Gedung, Konstruksi Baja, Transmisi, Telekomunikasi serta ... http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      www.pdf-finder.com/.../PENDIRIAN-PERUSAHAAN-NEGARA-TELEKOMUNIKASI-Peraturan-Pemerintah-....html - Cached
      Cool, Hipo Baby, Disney, Popeye, etc for SALE - Balita - Forum ...
       - [ Translate this page ]
      11 posts - 9 authors - Last post: 14 Aug 2006
      o iya kalau ada sepatu sama kaos kakinya juga donk... thanks...kirim ke melanie@wika.co.id. elisabeth 10/2/2006 7:11:00 PM ...
      www.parenting.co.id/forum/forum_detail.asp?catid=&pg... - Cached
      Get more discussion results
      PT. Wijaya karya ( persero) tbk - Indonesia - Info Perusahaan
       - [ Translate this page ]
      26 Jul 2008 ... Didirikan pada 11 Maret 1960 PT Wijaya Karya ( Persero) biasa disebut WIKA sebagai Badan Usaha Milik Negara ( BUMN) adalah hasil ...
      www-wika-co-id.indonetwork.co.id/.../pt-wijaya-karya-persero-tbk.htm - Cached - Similar
      www.balikpapan.go.id - www.bobbang.com
       - [ Translate this page ]
      www.wika.co.id. List Microsoft Certified Partners for Surabaya. Local Partner list: Microsoft Gold Certified Partners for Networking Infrastructure ...
      Vacancy Finance Staff PT. Wijaya Karya (Exp : July 30, 2010) | Jarno
       - [ Translate this page ]
      30 Jul 2010 ... novita@wika.co.id. Most people are coming to this page searching for : concrete products, wika beton banjarmasin, PT Wijaya Karya Beton ...
      jarno.web.id/.../vacancy-finance-staff-pt-wijaya-karya-exp-july-30-2010 - Cached
      Leading Company Pt Wijaya Karya | Kage Bunshin
       - [ Translate this page ]
      from wika.co.id. Wikacoid Leading Company PT Wijaya Karya. Posted Juni 30 ... from wika.co.id. Wikacoid. Posted Juni 30. Wikacoid Leading Company PT Wijaya ...
      reeex.com/post/leading-company--pt-wijaya-karya - Cached
      Loker Finance Staff PT Wijaya Karya (Persero) Tbk July 2010 ...
       - [ Translate this page ]
      27 Jul 2010 ... via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. Tags: Accounting, Finance. Search engine terms: ...
      www.lokeronline.com/loker-finance-staff-pt-wijaya-karya-persero-tbk-july-2010/ - Cached
      WIJAYA KARYA, PT - STEELINDONESIA.COM | Informasi Terlengkap ...
       - [ Translate this page ]
      Telp, No. Fax, Email, Kontak. 1, BRANCH OFFICE, Jl. Sutami Blk. i No. 2, +62 541 271693 begin_of_the_skype_highlighting              +62 541 271693      end_of_the_skype_highlighting, +62 541 271693 begin_of_the_skype_highlighting              +62 541 271693      end_of_the_skype_highlighting, wika-kaltim@wika.co.id, Hasiholan Christian Siahaan ...
      www.steelindonesia.com/003-005-wijaya-karya.htm - Indonesia - Cached
      IIM Catalog 071008.ai - www.pet--shops.com
       - [ Translate this page ]
      www.wika.co.id. Berita Pertambangan Indonesia Blog - Information, Comments, Reviews. Harga Kontrak Batubara Disesuaikan dengan Mekanisme Pasar; ...
      Lowongan Staf Keuangan PT Wijaya Karya (Exp: 30 Juli 2010)
       - [ Translate this page ]
      25 Jul 2010 ... kirim ke: pramusinto@wika.co.id atau novita@wika.co.id. Diposkan oleh SARIKERJA di 7/25/2010 08:20:00 PM. Label: Kontraktor, S-1 Akuntansi ...
      www.sarikerja.net/.../lowongan-staf-keuangan-pt-wijaya-karya.html - Cached
       - [ Translate this page ]
      http://www.wika.co.id. Address: Jl. Di. Panjaitan Kav. 3-4, Jakarta Timur, Jakarta Raya, Indones. Telephone: 62-21-8508650. Fax: 62-21-85911965. Google Map: ...
      www.gmdu.net/corp-235294.html - Cached
  78. - bgp.he.net
       - [ Translate this page ] · smtp.wika.co.id · · mail.anabatictech.co.id · · www.easzytravel.com · · vince.mitra.indo.net.id ...
      bgp.he.net/net/ - Cached
       - [ Translate this page ]
      Synergistic Innovative Growing - Wika.co.id Download Synergistic Innovative Growing - Wika.co.id. harga saham WIKA mengalami tekanan karena krisis . ...
      top-pdf.com/daftar-harga-pemanas-air-wika-2009.html - Cached
      WiLaYaH EmAs - www.bluerayhometheatersystems.com
       - [ Translate this page ]
      www.wika.co.id. Fear and Greed is human nature: January 2009. Dengan demikian, atas penghasilan yang diterima atau diperoleh TKI tersebut sehubungan dengan ...
  81. [DOC]
      1) Terkait dengan Prosedur Accpac:
       - [ Translate this page ]
      File Format: Microsoft Word - View as HTML
      Daftar tersebut bisa dikirimkan ke PIC Accpac Departemen (novita@wika.co.id) untuk diteruskan ke BSI. c) Untuk pengajuan tambahan nasabah baru (vendor ...
      Wahyu Eka Cahyana - People / info about name Wahyu Eka Cahyana ...
       - [ Translate this page ]
      Directors of Pelindo I which represented by Director of Finance Suwhono and Director of Commerce and Business Development Bambang Eka … www.wika.co.id ...
      www.yasni.com/wahyu+eka+cahyana/check+people - United States
      Subject: AS Academies and learned societies (General) - www ...
       - [ Translate this page ]
      ... memiliki secara langsung lebih dari 50% saham anak 184.615.400 lembar saham biasa seri B dijatahkan secara khusus. kepada Manajemen dan. www.wika.co.id ...
      Items where Year is 2005 - Diponegoro University | Institutional ...
       - [ Translate this page ]
      Brigjend TNI (Pur) Dadi Pratjipto, SE, Independent Commissioner Budi Harto , Director of Operation I. www.wika.co.id. SUARA MERDEKA - WACANA ...
      Global Collect International BV: BUMN
       - [ Translate this page ]
      Website : http://www.wika.co.id. KONSULTAN KONSTRUKSI 31. PT Bina Karya JL.D.I.PANJAITAN KAV.2. CAWANG JAKARTA TIMUR Phone : 8198445- 8195135 ...
      www.gcibv.co.cc/p/alamat-bumn-indonesian.html - Cached
      analisis profitabilitas sebelum dan sesudah memperoleh ppt - Free ...
       - [ Translate this page ]
      8. http://learningcenter.wika.co.id/FILES/eureka_page2f1e0a15815d... ppt description: Beban sebelum kontrak diperoleh (biaya pra kualifikasi, biaya lelang); ...
      www.linkpdf.com/.../analisis-profitabilitas-sebelum-dan-sesudah-memperoleh--.ppt - Cached
      Asosiasi Kontraktor Listrik Indonesia - Free Download - Docser
       - [ Translate this page ]
      From: wika.co.id - Size: 12mb. look within. dari perusahaan asosiasi tersebut serta dikurangi penerimaan dividen kas sejak ..... Dana Pensiun dan Kewajiban ...
      www.docser.com/q-Asosiasi-Kontraktor-Listrik-Indonesia - Cached
      Re: [bonsi97] Jual honda ferio
       - [ Translate this page ]
      9 Feb 2009 ... wika.co.id <tau...@wika.co.id> Subject: Re: [bonsi97] Jual honda ferio To: ... wika.co.id> To: <bonsi97@yahoogroups.com> Sent: Tuesday, ...
      www.mail-archive.com/bonsi97@yahoogroups.com/msg02357.html - Cached
      Arrow Resources Development
      PT Wika Realty (www.wika.co.id/eng/) is a fully integrated land and infrastructure builder/developer recently listed in the Jakarta Stock Exchange (JSX). ...
      www.arrowrd.com/home.html - Cached - Similar
  90. [PDF]
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      seleksi berikutnya akan diumumkan melalui website www.wika.co.id pada hari Kamis, 10 Juni 2010 mulai pukul 13.00. • Tahapan seleksi selanjutnya meliputi : ...
      Kokar-wika - Ragam News
       - [ Translate this page ]
      WIKA. 99% (Rp 50 M) Tahun. OP. Net Profit. margin ... Sumber: http://www.wika.co.id/data/download/Projected%20Invesment%202008.pdf ...
      www.ragamnews.com/topik/kokar-wika.html - Cached
      List of sites similar to Korindo99.com
       - [ Translate this page ]
      Screen shot of wika.co.id 2. WIKA (Wika.co.id, similar sites) Title: Wika Ranking: Wika is the world's 733351:th largest site (Alexa) Tags: wika ...
      similarurls.com/korindo99.com - Cached
      DT-88 MLM Unik Jadikan Belanja anda jadi penghasilan JAKARTA
       - [ Translate this page ]
      23 Agu 2007 ... Hp: 08159926379| Email: eko.h@wika.co.id| ID Iklan: 2514| Kota: JAKARTA| Keyword Google: DT-88 MLM Unik Jadikan Belanja anda jadi ...
      www.iklanpropertiku.com/detail.php?key1... - Indonesia - Cached
      Www+tradamaritime+com | Lowongan Kerja
       - [ Translate this page ]
      http://www.tradamaritime.com NA http://www.bankbtpn.co.id/ http://www.iikp.com http://www.alam-sutera.com http://www.wika.co.id http://www.enseval.com ...
      lowongankerjadi.com/search/www+tradamaritime+com - Indonesia - Cached
      surat keterangan praktek kerja pdf pdf downloads
       - [ Translate this page ]
      ( http://www.wika.co.id ); LABOUR CODE OF THE DEMOCRATIC REPUBLIC OF TIMOR LESTE; isu di tempat kerja atau hal-hal yang berkaitan dengan hubungan perburuhan ...
      www.pdfgeni.org/fd/surat-keterangan-praktek-kerja-pdf-pdf.html - Cached
      JPC ::
       - [ Translate this page ]
      6 posts - Last post: 30 Jun
      Berkas lamaran dapat dikirimkan melalui e-mail ke agus.widayat@wika.co.id / sentot@wika.co.id paling lambat 10 April 2009. ...
      Get more discussion results
      Ex-DKI_WIKA : Message: Re: [Ex-DKI_WIKA] undangan pengajian di ...
       - [ Translate this page ]
      8 posts - 2 authors - Last post: 11 Dec 2009
      Cc: "akmal malik" <akmal@.... id>, "budi cahyadi ex wika dki" <budi@efiplan. com>, "m chamim" <chamim@wika. co.id>, ...
      groups.yahoo.com/group/Ex-DKI_WIKA/message/26 - Cached
      Get more discussion results
      Puding bertanya tentang Teknologi Informasi [Archive] - myQuran
       - [ Translate this page ]
      28 Sep 2010 ... coba aja liat web site dudung.net, kompas.co.id, www.wika.co.id dll ini adalah contoh dari CMS. CMS Joomla, joomla adalah nama aplikasi CMS ...
      myquran.com/forum/archive/index.php/t-16760.html - Cached
      [INDONESIA] National Railways [Archive] - SkyscraperCity - www ...
       - [ Translate this page ]
      ... biaya perolehan serta akumulasi penyusutan dan dijual, pembangunan fasilitas yang dijanjikan ataupun yang menjadi kewajiban. www.wika.co.id ...
      Hutama Karya - Personen / Infos zu Name Hutama Karya - Personen ...
       - [ Translate this page ]
      Karya (www.wika.co.id), PT Hutama Karya und PT Waskita Karya (www.waskita.co.id) sowie die private PT ... www.gtai.de ...

    * Everything

    * Images
    * Videos
    * News
    * Books
    * Places
    * Blogs
    * Updates
    * Discussions


    * Kuala Lumpur, Federal Territory of Kuala Lumpur

    * Auto-detected

Change locationClose
Search Options
      wika.co.id. Winrar 3.90 Full Version « ITclub's Blog. Apalagi sekarang anda bisa mendownload yang Full Version, karena kalau anda ikhlas membelinya ...
      "Before You Demand, We Already There." - eBizzAsia Februari - www ...
       - [ Translate this page ]
      30 Sep 2010 ... www.wika.co.id. Hanura Duga BI Salahgunakan Kewenangan - INILAH.COM. Sebenarnya, menurut dia, merger dan akuisi sebenarnya tidak ada jika BI ...
      Lowongan PHP dan VB di PT. Wijaya Karya » bursa-kerja.net
       - [ Translate this page ]
      23 Agu 2010 ... Silahkan kirim CV anda ke email beben@wika.co.id untuk selanjutnya mendapatkan jadwal interview dan tes keahlian aplikasi. ...
      www.bursa-kerja.net/.../lowongan-php-dan-vb-di-pt-wijaya-karya.html - Cached
      Fw: [!! SPAM] Fw: Fwd: Bantuan - graduate-lp3i | Grup Google
       - [ Translate this page ]
      18 Feb 2009 ... wika.co.id>; Pak Bahar Pusat <bedo...@yahoo.com>; Pak bakri wika <bakr. ... wika.co.id>; mbak ririn dsu1 <ririn...@yahoo.com>; M'DIAN DEPT ...
      groups.google.co.id/group/graduate-lp3i/msg/0a8cd3dc4ca10daa - Cached
      Registrasi - WIKA e-Procurement System
       - [ Translate this page ]
      CV, Ltd, Firma, NV, Perum, PT. : : : Aceh, Bali, Bangka-Belitung, Banten, Bengkulu, D I Y, D K I, Gorontalo, Jambi, Jawa Barat, Jawa Tengah, Jawa Timur ...
      eproc.wika.co.id/indonesia/registrasi.php - Cached - Similar
      WIKA e-Procurement System
       - [ Translate this page ]
      Kebijakan Wika dalam pengadaan barang/jasa lebih memprioritaskan pengadaan secara langsung dari pabrikan, distributor resmi atau agen tunggal dan ...
      eproc.wika.co.id/indonesia/kebijakan.php - Cached
      Psak Nomor 59 | Pdf Search Engine Free Ebooks
       - [ Translate this page ]
      Berdasarkan Akta No. 59 tanggal 23 Mei 2008 mengenai ... http://www.wika.co.id/data/specialfeatures/WIKA%20KONSOLIDASI%20-%20MARET%202010.pdf ...
      www.pdf-searcher.com/pdf/psak-nomor-59.html - Cached
      Retensi Pelanggan | Pdf Search Engine Free Ebooks
       - [ Translate this page ]
      ... ARUS KAS DARI AKTIVITAS OPERASI Penerimaan Kas dari Pelanggan 4.585.214 ... http://www.wika.co.id/data/specialfeatures/LAPORAN%20WIKA%20DES%202007.pdf ...
      www.pdf-searcher.com/pdf/retensi-pelanggan.html - Cached
      e-ketawa :-) Trs: Rahasia Sukses....
       - [ Translate this page ]
      19 Jun 2009 ... wika..co.id>; santi <suntea_novia@ yahoo.com>; Primatexco-Ary <ari.june@gmail. com>; Primatexco-Ganjar <gn_plus@yahoo. co.id>; Popi Dian ...
      www.opensubscriber.com/message/e...com/12457365.html - Cached - Similar
      balirage.blogspot.com - www.dosiwa.com
       - [ Translate this page ]
      Wika.co.id. Laporan arus kas konsolidasian untuk aktivitas operasi disusun dasar aktivitas operasi, ... The Consolidated statement of cash. www.wika.co.id ...
      Bni securities Tips for ... | Tips-Search.com
       - [ Translate this page ]
      http://www.wika.co.id/data/download/wika%20113009%20(%20Maxi%20-%20BNI%20Securities).pdf. Burlington Northern Sante Fe (BNI) | Dividend Stock Profile . ...
      tips-search.com/c/.../tag/bni+securities+ - Cached
      IP 1661 3583 689 339046 1024 0 1443 http://piwik.org/faq/general ...
      ... 0 4 http://www.wika.co.id/ Indosatm2 7 21 19 2443 3 0 6 http://www.indosatm2.com/ Solonet 7 10 8 169 6 0 7 http://www.solonet.co.id/ Panasonic 6 9 9 241 ...
      pregool.com/piwik/?module=API&method...1... - Cached
      โหลดเพลง แค...Fproc/self/environ /index.php?option ...
       - [ Translate this page ]
      Fproc/self/environ /index.php?option=com_myblogcontroller=http://simhu.wika.co.id/simpak_603/subframe/gambar/kodok/ahai/fx29id1.txt??.mp3 โหลดเพลงแค.
      mp3zeed.com/mp3/index.php?search...wika.co.id%2Fsimpak... - Cached
      Year 2009 In Pelabuhan Ratu pdf documents | ebooks library download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/W... Preview pdf of Microsoft Word - WIKA CG Q2 2009 ver 2.3 · Microsoft Word - WIKA CG Q2 2009 ver 2.3 free download ...
      www.ebooklibs.com/year_2009_in_pelabuhan_ratu.html - Cached
      Lowongan Kerja PT. Wijaya Karya (WIKA) « IT SHARED
       - [ Translate this page ]
      25 Jul 2010 ... Wijaya Karya (persero), Tbk., Departemen Energi, Up. Koordinator Keuangan dan Akuntansi, via Email ke alamat berikut: pramusinto@wika.co.id; ...
      blogneea.wordpress.com/.../lowongan-kerja-pt-wijaya-karya-wika/ - Cached
      PT Indosiar Karya Media - Jakarta Indonesia - Company - www.dumdin.com
       - [ Translate this page ]
      19 Jan 2010... PT Wijaya Karya Beton (WIKA Beton) PT Wijaya Karya (WIKA) on Thursday, 28 June 2007 in WIKA's head office, Jakarta. www.wika.co.id ...
      Leading+company+pt+wijaya+karya | Kumpulan Tips Pilihan
       - [ Translate this page ]
      wika.co.id Leading Company - PT Wijaya Karya edit. international leading company in construction, perusahaan (source) ...
      tipsoke.com/tag/leading+company+pt+wijaya+karya - Cached
      Laporan Tahunan Bapepam Tahun 2002 PDF @ PDFWindows.Com
       - [ Translate this page ]
      Source: http://www.wika.co.id/data/specialfeatures/CODE%2520OF%2520CORPORATE%2520GOVERNANCE%25202009.pdf. Download 2009 Annual Report Bahasa Version PT ...
      www.pdfwindows.com/.../laporan+tahunan+bapepam+tahun+2002.html - Cached
      pt danpac futures Pdf
       - [ Translate this page ]
      0.05%. 8. PT Dhanawibawa Artha Cemerlang .. launched futures on the Dow Jones Industrial Average and Dow Jones Japan Titans www.wika.co.id - View - Download ...
      bukubaru.net/pt-danpac-futures.html - Cached
       - [ Translate this page ]
      pramusinto@wika.co.id. Atau novita@wika.co.id. Batas pengiriman lamaran paling lambat tanggal 30 Juli 2010. Job Interview Tips Practice ...
      TestCompany mail: [ob] Good website!
       - [ Translate this page ]
      15 Mei 2009 ... Sawedi(*)valeinco.com>, Sonny Setiawan <sonnysetiawan(*)wika.co.id>, Reza Siregar <Muhammad.Siregar(*)sampoerna.com>, Iskandar PTI - SOR ...
      testcompany.com/archive/May2009-19/11550.html - Cached
      laporan keuangan triwulan iii maret 2009 leading company pt pdf ...
       - [ Translate this page ]
      Iktisar Keuangan WIKA untuk Triwulan I-2009 (Unaudited). 2009 1) ... http://www.wika.co.id/data/download/WIKA_Press Release WIKA Q1 2009 ver 2.1.pdf ...
      www.ebookf.com/.../laporan-keuangan-triwulan-iii-maret-2009-leading-company-pt-book.pdf - Cached
      indonesian jobs vacancy
       - [ Translate this page ]
      14 Agu 2010 ... pramusinto@wika.co.id Atau novita@wika.co.id. Posted by Komunitas Blogger Indonesia at 8:25 PM 0 comments · Email This BlogThis! ...
      bursakerja.sman1ngunut.info/ - Cached
      anugrah - Document Search Engine - Rapid4search.com
       - [ Translate this page ]
      Toll road, Automotive, Heavy ... http://www.wika.co.id/data/download/WIKA%207%20September%202009%20(%20Pandu%20Anugrah%20-%20Bahana%20Securities).pdf ...
      docs.rapid4search.com/anugrah/page1/en - Cached
      Attn:Western Union Customer (Reply Now) - spam
       - [ Translate this page ]
      21 Apr 2010 ... If you need Clarification or have received this communication error please notify us immediately by responding to adwijaya@wika.co.id ...
      emailcondom.com/1232 - Cached
      harga tiang pancang - Free Online eBook Collection
       - [ Translate this page ]
      www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf ... market risk premium 6%, terminal growth 3%, dan WACC 15.2%, maka diperoleh target ...
      www.pdftop.com/ebook/harga+tiang+pancang/ - Cached
      Site details: Great Literary Works - Page: 2
      11 Okt 2010 ... rawURL=http%3A%2F%2Fwww.wika.co.id%2Fdata%2Fdownload%2FCLSA%252014%2520Mei%25202008.pdf&0=&1=0&4= ...
      start.facemoods.com/results.php?s...category=web&start=1... - Cached
      TT-Table Kotak info perusahaan
       - [ Translate this page ]
      ... (2000)Rp 18 milyar* (2001)Rp 26 milyar* (2002)Rp 30 milyar* (2003)Rp 46 milyar* (2004)Rp 96 milyar* (2005)Rp 96 milyar, 1000, http://www.wika.co.id/ ...
      toolserver.org/~kolossos/templatetiger/tt-table4.php?... - Cached
      Ikhsan Binarto - People / info about name Ikhsan Binarto - yasni ...
       - [ Translate this page ]
      Ikhsan Binarto, an analyst in PT Optima Securities said that the contracts will have a positive impact on WIKA especially on the revenue … www.wika.co.id ...
      Saham Wika Wijaya Karya Persero Tbk Land place
       - [ Translate this page ]
      D. Dalam hal PT Wijaya Karya (Persero) Tbk ... http://www.wika.co.id/data/specialfeatures/CODE%20OF%20CORPORATE%20GOVERNANCE%202009.pdf ...
      indo.nesiaku.com/story/saham+wika+wijaya+karya+persero+tbk.html - Cached
      Mencari wika di Semua Pilihan - Seluruh Dunia - Semua Hari ...
       - [ Translate this page ]
      PT. REKA CIPTA MANDIRI .... company called PT. WIJAYA KARYA ( Persero) Tbk. ( http: / / wika.co.id) .... Google Talk: karimkailane karimkailane ...
      indonetwork.web.id/alloffers/75/wika.html - Cached
       - [ Translate this page ]
      9 Jakarta 13340 Phone : 021 – 819 2808, 850 8640, 850 8650 Fax : 021 – 819 1235 Email : adwijaya@wika.co.id... PT. Intiland Development Tbk ...
      www.blogcatalog.com/.../company%20address%20%20%20alamat%20perusahaan/ - Similar
      Lowongan Kerja BUMN PT PT Wijaya Karya Terbaru | Lowongan Kerja
       - [ Translate this page ]
      28 Jul 2010 ... Wijaya Karya (Persero), Tbk., Departemen Energi, Up. Koordinator Keuangan & Akuntansi via email ke alamat email: pramusinto@wika.co.id atau ...
      lowongan-kerja.us/lowongan-kerja-bumn-pt-pt-wijaya-karya-terbaru/ - Cached
       - [ Translate this page ]
      Surat Keputusan Direksi No. 01.09/A.DIR 0702 ... http://www.wika.co.id/data/download/WIKA%20Financial%20Statement%20September%202008,%20Unaudited.pdf ...
      www.pdfchaser.com/.../KEPUTUSAN-DIREKSI-PT-(PERSERO)-PELABUHAN-INDONESIA-I.html - Cached
      Situs Jual Beli Kapal Pertama Di Indonesia :: IndonesianShip.com
       - [ Translate this page ]
      Nama : | Email : oong@wika.co.id | Telepon : 0812 8343522 | Fax : Vacancy in Fabrication Yard. Saipem, 43% owned by Eni S.p.A., is organized into three ...
      www.indonesianship.com/CrewsMarket.asp?offset=10 - Cached
      Aktiva Tetap | My PDF Search Engine Free Ebooks
       - [ Translate this page ]
      ... Tanah Belum Dikembangkan Land for Development Aktiva Tetap Fixed ... http://www.wika.co.id/data/specialfeatures/LAPORAN%20WIKA%20DES%202007.pdf ...
      www.mypdfsearchengine.com/pdf/aktiva-tetap.html - Cached
      Lintas Berita - Wika Konstruksi - Pengumuman Peserta Seleksi ...
       - [ Translate this page ]
      Untuk Informasi lebih lanjut, Silahkan ke http://www.wika.co.id/ina/company_info/index.php?act=special_feature. baca selengkapnya. ...
      www.lintasberita.com/.../wika-konstruksi-pengumuman-peserta-seleksi-wawancara-psikologi - Cached
      Kontraktor « Konstruksi dan Pemeliharaan « Bisnis | Daftar Website ...
       - [ Translate this page ]
      PT Wijaya Karya (Persero) Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, Tangerang and Bekasi ... http://www.wika.co.id ...
      daftarweb.org/Bisnis/Konstruksi_dan.../Kontraktor - Indonesia - Cached - Similar
      • Wijaya Karya In Trade Pt • Jakarta • Peralatan rumah, Jasa dan ...
       - [ Translate this page ]
      Wika.co.id - Site Info from Alexa PT Wijaya Karya. About PT Wijaya Karya (wika.co.id): A state-owned enterprise involved in construction, manufacturing, ...
      www.tuugo.net/Companies/wijaya-karya-in...pt.../0160001872299 - Cached
       - [ Translate this page ]
      25 Jul 2010 ... Wijaya Karya (Persero), Tbk., Departemen Energi, Up. Koordinator Keuangan & Akuntansi via email ke alamat berikut ini. pramusinto@wika.co.id ...
      lowongan-kerja1.co.cc/lowongan-kerja-terbaru-pt-wijaya-karya-fresh-graduate-are-welcome-mei-2010-lowongan-pekerjaan-terbaru-2010... - Cached
      PT Wijaya Karya (Persero) - Finance Staff - Bursa Lowongan Kerja ...
       - [ Translate this page ]
      via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. « PT. Kimberly-Clark Indonesia - Electrician ...
      www.zimbio.com/.../PT+Wijaya+Karya+Persero+Finance+Staff - Cached
      Wijaya Karya Beton | Wijaya Karya Beton
       - [ Translate this page ]
      Direktur Alamat Lengkap Jl Bambang Utoyo Rama Kasih Raya 957 - Palembang - Indonesia Telephone 0711-712534. Fax 0711-720093. Website www.wika.co.id. Brosur.
      wkb-palembang.yptrading.co.id/ - Cached
      struktur modal pt jasa marga - Free PDF Resource And Files - on ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Mega%20Capital%20Indonesia%2030%20Juni%202008.pdf. Pendapatan dari jasa konstruksi memberikan kontribusi dari IDR408, ...
      www.dailybust.com/pdf-files/struktur-modal-pt-jasa-marga - Cached
      Berita tentang indopos co id indo pos online | Berita Terkini
       - [ Translate this page ]
      smtp.wika.co.id: 15: 85005: 0.16%: 83481: 0.21% ... jawa pos online: 13: 422: 0.72%: indopos: 14: 409: 0.70%: jawa pos pdf ... jawapos online: 18: 234: ...
      zeuder.co.cc/news/indopos+co+id+indo+pos+online - Cached
      Weston Essential Housewares - www.shopweston.com - administrator
       - [ Translate this page ]
      purwanto, Jl Biru Laut I No 4 Jaktim, 13340, jakarta, purwanto.g@wika.co.id, H: 8192808. M: 085230008221, view detail. RIYA NURFITRIYANNA EKA ATDMAJA, JL. ...
      adm.shopweston.com/shopweston.php?page=visitor...1... - Cached
      World Wide Web Virtual Library: Papua, Indonesia (via PapuaWeb ...
      22 Oct 2005... the assistance of AusAID (working with the Indonesian contractor PT Wijaya Karya at www.wika.co.id), most other towns in Papua continue ...
      www.papuaweb.org/vl/www/04.html - Cached - Similar
      WebMii - Karya Wijaya
       - [ Translate this page ]
      http://www.wika.co.id/data/download/7May09-WIKA,%201Q09%20Profit%20Fueled%20by%20Upbeat%20Margin%20(%20Stanley%20Tjiandra%20-%20Trimegah%20Sec).pdf ...
      www.webmii.es/Result.aspx/Karya/Wijaya - Cached
      Jembatan Rangka Baja pdf document, ebook
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA%207%20September%202009%20(%20Pandu%20Anugrah%20-%20Bahana%20Securities).pdf ...
      ebookpedia.net/ebook/jembatan-rangka-baja.html - United States
      Tempointeraktif.Com - Pemisahan Anak Perusahaan PLN Dibatalkan ...
       - [ Translate this page ]
      Manager di Kamboja • WIKA Peduli Yogyakarta dan Jawa Tengah Knowledge Enterprise Award • WIKA Tawarkan Saham Perusahaan Anak. www.wika.co.id ...
      laporan keuangan 31 desember 2008 syariah mandiri PDF
       - [ Translate this page ]
      31 Des 2008 ... 2751189909. 446296470. PT. Bank Syariah BRI ... http://www.wika.co.id/data/specialfeatures/WIKA%20KONSOLIDASI%20-%20MARET%202010.pdf ...
      pdf.hulufile.com/laporan-keuangan-31-desember-2008-syariah-mandiri-page5.html - Cached
      pt mahkota inti citra pdf search tw 1 docpdf
       - [ Translate this page ]
      PT. 1636207260. 2053728237. Belleza ... http://www.wika.co.id/data/download/WIKA%2520Financial%2520Statement%2520September%25202008,%2520Unaudited.pdf ...
      www.docpdf.org/tw/pt%20mahkota%20inti%20citra-pdf-page1.html - Cached
      nusa wijaya - free people search
       - [ Translate this page ]
      ... the first co-development of building by government and private sector, ... http://www.wika.co.id/eng/invesrel/index.php%3Fact%3Ddetailnews%26p_id%3D45 ...
      laporan neraca bank btpn 31 desember 2009 ebook books Download
       - [ Translate this page ]
      http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf. mdkey: cfa609ba56f4a336ad2b2b1f0f703573. TAG wijaya karya telah dari hasil pt wijaya ...
      www.edu-doc.com/index.php?q=laporan+neraca+bank+btpn... - Cached
      Daftar Link Situs BUMN Indonesia
       - [ Translate this page ]
      16 Des 2009 ... PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi ...
      adegustiann.blogsome.com/.../daftar-link-situs-bumn/ - Indonesia - Cached - Similar
      Free download pdf: CONTOH LAPORAN KEUANGAN PERUSAHAAN tahun 2009
       - [ Translate this page ]
      ... dari laporan keuangan secara keseluruhan ... Perusahaan sd 30 September untuk tahun 2009 dan 2008 adalah sebesar Rp.1.477.833. ... www.wika.co.id ...
      www.2dix.com/.../contoh-laporan-keuangan-perusahaan-tahun-2009-pdf.php - Cached
       - [ Translate this page ]
      ... menghasilkan produk ... persetujuan pada Rapat Dewan Komisaris selambat-lambatnya 60 (enam puluh) hari ... www.wika.co.id | View PDF | Download PDF ...
      www.pdf.kq5.org/search/RAPAT+DEWAN+MANAJEMEN+LABA - Cached
      Direktori Alamat Instansi Non Kementerian Pekerjaan Umum ...
       - [ Translate this page ]
      Jl. D. I. Panjaitan Kav. 9 Jakarta 13340. Telepon. : 021-8192808. Fax. : 021-8191235. Email. : adiwijaya(at)wika.co.id. Website. : http://www.wika.co.id ...
      pustaka.pu.go.id/new/alamat-lain.asp?start=41 - Cached
      METRO TV NEWS - www.wunwan.com
       - [ Translate this page ]
      Tuban Aromatic Plant Gas Power Plant-Tuban, Jatim : Wika-Adhi Grati Combine Cycle Power Plant 6 X 150 MW-Pasuruan West Java. www.wika.co.id ...
      PT Reca Cipta Mandiri Utama - Indonesia - Company Info
      WIJAYA KARYA ( Persero) Tbk. ( http: / / wika.co.id) encompassing function such as venue trading management and finance development. ...
      pt-rcmu.itrademarket.com/profile/pt-reca-cipta-mandiri-utama.htm - Cached
      Partners - www.henjai.com
       - [ Translate this page ]
      28 Jul 2010 ... PT Wijaya Karya Beton (WKB) , merupakan perusahaan yang memproduksi beton pre-cast panel dan. www.wika.co.id ...
       - [ Translate this page ]
      30 Okt 2009 ... Kepada: corporate-care-7@wika.co.id. Tanggal: Selasa, 1 September, 2009, 6:02 AM Siang Pak Hermawan, Saya pernah denger dari p suardi bahar ...
      ccp7.blogspot.com/ - Cached
      Bahana - Pipl Profiles
       - [ Translate this page ]
      [ www.wika.co.id ]. co.id,Cement,Bahana Securities,Indonesia,market share,y-o-y,, Disclosure: Bahana Securities does and seeks to do business ...
      pipl.com/directory/name/Bahana - United States
      pltu pln pdf pdf no
       - [ Translate this page ]
      Perusahaan Listrik Negara (PLN ... http://www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf. PT. INDO MULTI KARYA ...
      www.96147.com/no/pltu%20pln%20pdf.html - Cached
      Search email di google (lihat penjelasan di email) keyword: "nama ...
       - [ Translate this page ]
      ... waterbom-jakarta.com watytjakra.com web.de webcenter.co.id websquash-marketing.com wedrybest.com wika.co.id wintermar.com wiratman.co.id wireless.co.id ...
      www.bisnis5milyar.com/.../Keyword%20Google.txt - Indonesia - Cached - Similar
      Lowongan Staf Keuangan Pt Wijaya Karya Exp 30 Juli 2010
       - [ Translate this page ]
      Wijaya Karya (Persero), Tbk., Departemen Energi, Up. Koordinator Keuangan & Akuntansi via email ke alamat berikut ini. pramusinto@wika.co.id ...
      commentportal.com/.../lowongan-staf-keuangan-pt-wijaya-karya-exp-30-juli-2010 - Cached
      pltu pln pdf - Sz Web Search
       - [ Translate this page ]
      ... PLTU Kalimantan Selatan senilai total Rp 1,2 Trilliun milik PT PLN ... http://www.wika.co.id/data/download/WIKA_PressRelease_GroundBreaking_ver.1.5. ...
      www.sz-pet.com/pltu%20pln%20pdf.html - United States - Cached
       - [ Translate this page ]
      Gedung, Konstruksi Baja, Transmisi, Telekomunikasi serta ... http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      www.pdf-finder.com/.../PENDIRIAN-PERUSAHAAN-NEGARA-TELEKOMUNIKASI-Peraturan-Pemerintah-....html - Cached
      Cool, Hipo Baby, Disney, Popeye, etc for SALE - Balita - Forum ...
       - [ Translate this page ]
      11 posts - 9 authors - Last post: 14 Aug 2006
      o iya kalau ada sepatu sama kaos kakinya juga donk... thanks...kirim ke melanie@wika.co.id. elisabeth 10/2/2006 7:11:00 PM ...
      www.parenting.co.id/forum/forum_detail.asp?catid=&pg... - Cached
      Get more discussion results
      PT. Wijaya karya ( persero) tbk - Indonesia - Info Perusahaan
       - [ Translate this page ]
      26 Jul 2008 ... Didirikan pada 11 Maret 1960 PT Wijaya Karya ( Persero) biasa disebut WIKA sebagai Badan Usaha Milik Negara ( BUMN) adalah hasil ...
      www-wika-co-id.indonetwork.co.id/.../pt-wijaya-karya-persero-tbk.htm - Cached - Similar
      www.balikpapan.go.id - www.bobbang.com
       - [ Translate this page ]
      www.wika.co.id. List Microsoft Certified Partners for Surabaya. Local Partner list: Microsoft Gold Certified Partners for Networking Infrastructure ...
      Vacancy Finance Staff PT. Wijaya Karya (Exp : July 30, 2010) | Jarno
       - [ Translate this page ]
      30 Jul 2010 ... novita@wika.co.id. Most people are coming to this page searching for : concrete products, wika beton banjarmasin, PT Wijaya Karya Beton ...
      jarno.web.id/.../vacancy-finance-staff-pt-wijaya-karya-exp-july-30-2010 - Cached
      Leading Company Pt Wijaya Karya | Kage Bunshin
       - [ Translate this page ]
      from wika.co.id. Wikacoid Leading Company PT Wijaya Karya. Posted Juni 30 ... from wika.co.id. Wikacoid. Posted Juni 30. Wikacoid Leading Company PT Wijaya ...
      reeex.com/post/leading-company--pt-wijaya-karya - Cached
      Loker Finance Staff PT Wijaya Karya (Persero) Tbk July 2010 ...
       - [ Translate this page ]
      27 Jul 2010 ... via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. Tags: Accounting, Finance. Search engine terms: ...
      www.lokeronline.com/loker-finance-staff-pt-wijaya-karya-persero-tbk-july-2010/ - Cached
      WIJAYA KARYA, PT - STEELINDONESIA.COM | Informasi Terlengkap ...
       - [ Translate this page ]
      Telp, No. Fax, Email, Kontak. 1, BRANCH OFFICE, Jl. Sutami Blk. i No. 2, +62 541 271693 begin_of_the_skype_highlighting              +62 541 271693      end_of_the_skype_highlighting, +62 541 271693 begin_of_the_skype_highlighting              +62 541 271693      end_of_the_skype_highlighting, wika-kaltim@wika.co.id, Hasiholan Christian Siahaan ...
      www.steelindonesia.com/003-005-wijaya-karya.htm - Indonesia - Cached
      IIM Catalog 071008.ai - www.pet--shops.com
       - [ Translate this page ]
      www.wika.co.id. Berita Pertambangan Indonesia Blog - Information, Comments, Reviews. Harga Kontrak Batubara Disesuaikan dengan Mekanisme Pasar; ...
      Lowongan Staf Keuangan PT Wijaya Karya (Exp: 30 Juli 2010)
       - [ Translate this page ]
      25 Jul 2010 ... kirim ke: pramusinto@wika.co.id atau novita@wika.co.id. Diposkan oleh SARIKERJA di 7/25/2010 08:20:00 PM. Label: Kontraktor, S-1 Akuntansi ...
      www.sarikerja.net/.../lowongan-staf-keuangan-pt-wijaya-karya.html - Cached
       - [ Translate this page ]
      http://www.wika.co.id. Address: Jl. Di. Panjaitan Kav. 3-4, Jakarta Timur, Jakarta Raya, Indones. Telephone: 62-21-8508650. Fax: 62-21-85911965. Google Map: ...
      www.gmdu.net/corp-235294.html - Cached
  78. - bgp.he.net
       - [ Translate this page ] · smtp.wika.co.id · · mail.anabatictech.co.id · · www.easzytravel.com · · vince.mitra.indo.net.id ...
      bgp.he.net/net/ - Cached
       - [ Translate this page ]
      Synergistic Innovative Growing - Wika.co.id Download Synergistic Innovative Growing - Wika.co.id. harga saham WIKA mengalami tekanan karena krisis . ...
      top-pdf.com/daftar-harga-pemanas-air-wika-2009.html - Cached
      WiLaYaH EmAs - www.bluerayhometheatersystems.com
       - [ Translate this page ]
      www.wika.co.id. Fear and Greed is human nature: January 2009. Dengan demikian, atas penghasilan yang diterima atau diperoleh TKI tersebut sehubungan dengan ...
  81. [DOC]
      1) Terkait dengan Prosedur Accpac:
       - [ Translate this page ]
      File Format: Microsoft Word - View as HTML
      Daftar tersebut bisa dikirimkan ke PIC Accpac Departemen (novita@wika.co.id) untuk diteruskan ke BSI. c) Untuk pengajuan tambahan nasabah baru (vendor ...
      Wahyu Eka Cahyana - People / info about name Wahyu Eka Cahyana ...
       - [ Translate this page ]
      Directors of Pelindo I which represented by Director of Finance Suwhono and Director of Commerce and Business Development Bambang Eka … www.wika.co.id ...
      www.yasni.com/wahyu+eka+cahyana/check+people - United States
      Subject: AS Academies and learned societies (General) - www ...
       - [ Translate this page ]
      ... memiliki secara langsung lebih dari 50% saham anak 184.615.400 lembar saham biasa seri B dijatahkan secara khusus. kepada Manajemen dan. www.wika.co.id ...
      Items where Year is 2005 - Diponegoro University | Institutional ...
       - [ Translate this page ]
      Brigjend TNI (Pur) Dadi Pratjipto, SE, Independent Commissioner Budi Harto , Director of Operation I. www.wika.co.id. SUARA MERDEKA - WACANA ...
      Global Collect International BV: BUMN
       - [ Translate this page ]
      Website : http://www.wika.co.id. KONSULTAN KONSTRUKSI 31. PT Bina Karya JL.D.I.PANJAITAN KAV.2. CAWANG JAKARTA TIMUR Phone : 8198445- 8195135 ...
      www.gcibv.co.cc/p/alamat-bumn-indonesian.html - Cached
      analisis profitabilitas sebelum dan sesudah memperoleh ppt - Free ...
       - [ Translate this page ]
      8. http://learningcenter.wika.co.id/FILES/eureka_page2f1e0a15815d... ppt description: Beban sebelum kontrak diperoleh (biaya pra kualifikasi, biaya lelang); ...
      www.linkpdf.com/.../analisis-profitabilitas-sebelum-dan-sesudah-memperoleh--.ppt - Cached
      Asosiasi Kontraktor Listrik Indonesia - Free Download - Docser
       - [ Translate this page ]
      From: wika.co.id - Size: 12mb. look within. dari perusahaan asosiasi tersebut serta dikurangi penerimaan dividen kas sejak ..... Dana Pensiun dan Kewajiban ...
      www.docser.com/q-Asosiasi-Kontraktor-Listrik-Indonesia - Cached
      Re: [bonsi97] Jual honda ferio
       - [ Translate this page ]
      9 Feb 2009 ... wika.co.id <tau...@wika.co.id> Subject: Re: [bonsi97] Jual honda ferio To: ... wika.co.id> To: <bonsi97@yahoogroups.com> Sent: Tuesday, ...
      www.mail-archive.com/bonsi97@yahoogroups.com/msg02357.html - Cached
      Arrow Resources Development
      PT Wika Realty (www.wika.co.id/eng/) is a fully integrated land and infrastructure builder/developer recently listed in the Jakarta Stock Exchange (JSX). ...
      www.arrowrd.com/home.html - Cached - Similar
  90. [PDF]
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      seleksi berikutnya akan diumumkan melalui website www.wika.co.id pada hari Kamis, 10 Juni 2010 mulai pukul 13.00. • Tahapan seleksi selanjutnya meliputi : ...
      Kokar-wika - Ragam News
       - [ Translate this page ]
      WIKA. 99% (Rp 50 M) Tahun. OP. Net Profit. margin ... Sumber: http://www.wika.co.id/data/download/Projected%20Invesment%202008.pdf ...
      www.ragamnews.com/topik/kokar-wika.html - Cached
      List of sites similar to Korindo99.com
       - [ Translate this page ]
      Screen shot of wika.co.id 2. WIKA (Wika.co.id, similar sites) Title: Wika Ranking: Wika is the world's 733351:th largest site (Alexa) Tags: wika ...
      similarurls.com/korindo99.com - Cached
      DT-88 MLM Unik Jadikan Belanja anda jadi penghasilan JAKARTA
       - [ Translate this page ]
      23 Agu 2007 ... Hp: 08159926379| Email: eko.h@wika.co.id| ID Iklan: 2514| Kota: JAKARTA| Keyword Google: DT-88 MLM Unik Jadikan Belanja anda jadi ...
      www.iklanpropertiku.com/detail.php?key1... - Indonesia - Cached
      Www+tradamaritime+com | Lowongan Kerja
       - [ Translate this page ]
      http://www.tradamaritime.com NA http://www.bankbtpn.co.id/ http://www.iikp.com http://www.alam-sutera.com http://www.wika.co.id http://www.enseval.com ...
      lowongankerjadi.com/search/www+tradamaritime+com - Indonesia - Cached
      surat keterangan praktek kerja pdf pdf downloads
       - [ Translate this page ]
      ( http://www.wika.co.id ); LABOUR CODE OF THE DEMOCRATIC REPUBLIC OF TIMOR LESTE; isu di tempat kerja atau hal-hal yang berkaitan dengan hubungan perburuhan ...
      www.pdfgeni.org/fd/surat-keterangan-praktek-kerja-pdf-pdf.html - Cached
      JPC ::
       - [ Translate this page ]
      6 posts - Last post: 30 Jun
      Berkas lamaran dapat dikirimkan melalui e-mail ke agus.widayat@wika.co.id / sentot@wika.co.id paling lambat 10 April 2009. ...
      Get more discussion results
      Ex-DKI_WIKA : Message: Re: [Ex-DKI_WIKA] undangan pengajian di ...
       - [ Translate this page ]
      8 posts - 2 authors - Last post: 11 Dec 2009
      Cc: "akmal malik" <akmal@.... id>, "budi cahyadi ex wika dki" <budi@efiplan. com>, "m chamim" <chamim@wika. co.id>, ...
      groups.yahoo.com/group/Ex-DKI_WIKA/message/26 - Cached
      Get more discussion results
      Puding bertanya tentang Teknologi Informasi [Archive] - myQuran
       - [ Translate this page ]
      28 Sep 2010 ... coba aja liat web site dudung.net, kompas.co.id, www.wika.co.id dll ini adalah contoh dari CMS. CMS Joomla, joomla adalah nama aplikasi CMS ...
      myquran.com/forum/archive/index.php/t-16760.html - Cached
      [INDONESIA] National Railways [Archive] - SkyscraperCity - www ...
       - [ Translate this page ]
      ... biaya perolehan serta akumulasi penyusutan dan dijual, pembangunan fasilitas yang dijanjikan ataupun yang menjadi kewajiban. www.wika.co.id ...
      Hutama Karya - Personen / Infos zu Name Hutama Karya - Personen ...
       - [ Translate this page ]
      Karya (www.wika.co.id), PT Hutama Karya und PT Waskita Karya (www.waskita.co.id) sowie die private PT ... www.gtai.de ...

    * Everything

    * Images
    * Videos
    * News
    * Books
    * Places
    * Blogs
    * Updates
    * Discussions


    * Kuala Lumpur, Federal Territory of Kuala Lumpur

    * Auto-detected

Change locationClose
Search Options

          o The web
          o Pages from Malaysia

Fewer search toolsMore search tools
Previous	1	2	3	4	5	Next
	Search settings | Sign in
Advanced search
Page 3 of about 29,400 results (0.13 seconds) 
Search Results

      Complete List of Indonesian Company | Indonesia Associate
       - [ Translate this page ]
      http://www.wika.co.id http://www.enseval.com. NA http://www.jababeka.com http://www.cmnp.co.id http://www.bhakti-investama.com http://www.acehardware.co.id/ ...
      www.indonesiaassociate.com/.../complete-list-of-indonesian-company.html - Cached
      Rev Edit Ar Wika Ok - Petrochemical Oil Jobs
       - [ Translate this page ]
      Hadori & Rekan. HLB ... Source :http://www.wika.co.id/data/specialfeatures/AnnualReport2007.pdf. Thanks site is goodpczypc ...
      www.petrochemicaloiljobs.com/jobsearch/rev+edit+ar+wika+ok - Cached
      Leading Company Pt Wijaya Karya - Petrochemical Oil Jobs
       - [ Translate this page ]
      PT Wijaya Karya (Persero) Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, ... Source :http://www.wika.co.id/ ...
      www.petrochemicaloiljobs.com/.../leading+company+pt+wijaya+karya - Cached
      2009 In Pelabuhan Ratu pdf documents | ebooks library download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/W... Preview pdf of Microsoft Word - WIKA CG Q2 2009 ver 2.3 · Microsoft Word - WIKA CG Q2 2009 ver 2.3 free download ...
      www.ebooklibs.com/2009_in_pelabuhan_ratu.html - Cached
      IP 201 456 71 47920 121 0 179 http://piwik.org/faq/general/#faq_52 ...
      ... 365 77 28632 110 0 160 http://www.telkom.net.id/ Fast 5 11 10 1557 3 0 5 http://www.fast.net.id/ Wika 3 3 2 30 3 0 2 http://www.wika.co.id/ Blackberry 3 ...
      pregool.com/piwik/?module=API&method...1... - Cached
      Samepoint Social Conversation Search wika | Groups
       - [ Translate this page ]
      Gw rasa Prospek wika (Wijaya Karya) kedepanya bagus. sekarang wika dah banyak ikut tender ... bener gan situsnya www.wika.co.id. kalau da bukan buat ...
      www.samepoint.com/groups.php?q=wika - United States - Cached
      Samepoint Social Conversation Search adji kurniawan | page 5 of ...
       - [ Translate this page ]
      Negatives Words: (None found in this post) | + Positive Words: (None found in this post). Tweet - Original on: wika.co.id - Search this source ...
      www.samepoint.com/docs.php?page=5&q=adji... - United States - Cached
      trimegah securities PDF Download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/30Jul09,%20WIKA,%20Better-than-Expected%201H09%20on%20Buoyant%20Margins%20(Stanley%20Tjiandra%20-%20Trimegah%20Sec).pdf ...
      www.book925.com/trimegah-securities-pdf.html - Cached
       - [ Translate this page ]
      WEB Add : www.wika.co.id. No. NPWP : 01.001.615.2-051.000 begin_of_the_skype_highlighting              001.615.2-051.000      end_of_the_skype_highlighting. No. SIUP/TDUP : 04657/1.824.271 (Tgl : 21-07-2008) No Anggota KADIN : 00120 ...
      www.jakartacci.com/webpages/bsk/listing/jt/30185.htm - Cached
      Laporan Keuangan 31 Desember 2008 Pt Bank Syariah Bukopin Pdf ...
       - [ Translate this page ]
      by: http://www.wika.co.id/data/download/Laporan%2520Keuangan%2520Konsolidasi%252031%2520Des%252008%2520Audited%2520%2B%2520Catatan%2520atas%2520Laporan% ...
      muizzaddin.com/?s=laporan+keuangan+31...pt... - Indonesia - Cached
      Get Domain Name Ip Address pkbl.bumn.go.id; Whois Lookup For go.id
       - [ Translate this page ]
      www.wika.co.id · Whois domain registration for www.wika.co.id whois. Indonesia's Leading Integrated EPC & Investment Company construction bumn company of ...
      domainsbyip.com/domaintoip/pkbl.bumn.go.id/ - Cached
      Laporan Segmen Triwulan Perusahaan .pdf Download
       - [ Translate this page ]
      ... tiap segmen berdasarkan bidang usaha. Perusahaan menerapkan ... http://www.wika.co.id/data/download/LAPKEU MARET 2009 - REVISED.pdf; Preview Maximize ...
      www.pdfph.com/pdf/laporan-segmen-triwulan-perusahaan/ - Cached
      Contoh Laporan Keuangan Perusahaan Jasa Konstruksi .pdf Download
       - [ Translate this page ]
      Pada laporan keuangan per 31 Desember 2008, Perusahaan belum menerapkan ketentuan ... http://www.wika.co.id/data/download/Laporan Keuangan Konsolidasi 31 ...
      www.pdfph.com/.../contoh-laporan-keuangan-perusahaan-jasa-konstruksi/ - Cached
      Leading Company Pt Wijaya Karya Iklan Baris Pendidikan @Kopertis2.Org
       - [ Translate this page ]
      Leading Company PT Wijaya Karya. WIKA Provides Amounts Of Information That Would Be Important To An Investor Making An Investment from wika.co.id ...
      kopertis2.org/education/leading_company__pt_wijaya_karya.html - Cached
      Kepemilikan Minoritas - JEVUSKA
       - [ Translate this page ]
      ... tidak lancar 764305983092 738336597236 hak kepemilikan minoritas dalam anak. Source: http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      www.jevuska.com/topic/kepemilikan+minoritas.html - Indonesia - Cached
      Wijaya Karya Tbk, PT | Jakarta, Indonesia | Company Profile ...
       - [ Translate this page ]
      ()62 021 819-2808, 62 021 819-1235 fax, http://www.wika.co.id. Primary SIC: Land Subdividers & Developers, Not Elsewhere Classified, ...
      goliath.ecnext.com/.../product-compint-0001377509-page.html - Cached - Similar
      Tabung Elpiji Vektor | fictivedesign.com
       - [ Translate this page ]
      Download your favorite logo elpiji vektor at wika.co.id//download/WIKA_0724_IDI_WIKA Akan Naikan Kapasitas Produksi Tabung Elpiji.pdf ...
      fictivedesign.com/search/tabung+elpiji+vektor - Cached
      Bahana Daily - www.dosiwa.com
       - [ Translate this page ]
      4 Sep 2010 ... Source: Company. Expanding beyond traditional Heri Sunaryadi. President Director. ext 3000. heri@bahana.co.id. Research. www.wika.co.id ...
      Yusup Persat Sembiring - Portfolio on BrightFuse - A Talent - www ...
       - [ Translate this page ]
      www.wika.co.id. Banyu Urip Project | PT. LISA CONCRETE INDONESIA. Facade Proyek PLTU PAITON; RC BOX CULVERT di Menur; Rivetment di Jawa Tengah Atasi Banjir, ...
      company update microsoft powerpoint company update 2009 pdf - Free ...
      2009 : - Perubahan PT CIP menjadi PT WIKA Insan Pertiwi ... Investment Company in South East Asia ... http://www.wika.co.id/data/download/Company Update.pdf ...
      www.ebookf.com/.../company-update-microsoft-powerpoint-company-update-2009-book.pdf - Cached
      hubungan dengan pihak istimewa pdf - Free unlimited eBook search ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Laporan Keuangan Konsolidasi 31 Des 08 Audited Catatan atas Laporan Keuangan - PT Wijaya Karya (Persero) Tbk.pdf ...
      www.ebookf.com/hu/hubungan-dengan-pihak-istimewa-book.pdf - Cached
      BUY Adhi Karya | PDFGirl | PDF Search Engine
       - [ Translate this page ]
      ... 294 6 0.18 17.3 1.4 26.5 Adhi Karya Indonesia 94 485 0.05 4.6 1.0 2.7 Wijaya Karya ... http://www.wika.co.id/data/download/Bahana%2010%20Juni%202010.pdf ...
      www.pdfchaser.com/pdf/BUY-Adhi-Karya.html - Cached
       - [ Translate this page ]
      ... unicorporated PT Wijaya Karya (Persero) Tbk (IDX issuer code: WIKA), Tsukishima Kikai Co. Ltd and PT Nusantara Energi Abadi ... http://www.wika.co.id ...
      Pt Pln » maxall's blog
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA_Release_GroundBreaking_PLTU_TanjungPriok_ver.1.3_webeng.pdf. Karaha Bodas and Himpurna arbitrations ...
      maxall.web.id/berita/pt-pln.html - Cached
      bernardo@a_paris dontask@bitch.net bilotta@domain.com.br ...
      COM adwijaya@wika.co.id cyhii@tm.net.my sakt@hotmail.com jdean@rogers.wave.ca vajdam@ny.bgytf.hu VivaEP@aol.com rohjk@wincomsoft.com okul_0kul@hotmail.com ...
      Business &amp; Financial News, Breaking US &amp; International ...
       - [ Translate this page ]
      Leading Company - PT Wijaya Karya. • Mahkota Inti Citra • Ministry of Regional Infrastructure Indofood Sukses Makmur • Ericsson •. www.wika.co.id ...
      PT Indocards Sukses Makmur - www.sungkom.com
       - [ Translate this page ]
      21 Jul 2010 ... Civil Foundation for Baby food Factory-Sukabumi : PT. Indofood Sukses Makmur : 22,5 B : 2003 - 2004. www.wika.co.id ...
      manajemen piutang Pdf
       - [ Translate this page ]
      ... saldo akun piutang usaha pada akhir tahun, manajemen. Perusahaan berpendapat bahwa jumlah penyisihan piutang www.wika.co.id - View - Download ...
      bukubaru.net/manajemen-piutang.html - Cached
      penerimaan pegawai pt pelabuhan indonesia i persero bursa kerja Pdf
       - [ Translate this page ]
      ... penerimaan sampai dengan tahun 2006, untuk pegawai .. Bank Rakyat Indonesia (Persero). 2084067594. PT. Bank Jawa Barat www.wika.co.id - View - Download ...
      bukubaru.net/penerimaan-pegawai-pt-pelabuhan-indonesia-i-persero-bursa-kerja.html - Cached
      July 2010
       - [ Translate this page ]
      pramusinto@wika.co.id Atau novita@wika.co.id. Posted by Komunitas Blogger Indonesia at 8:25 PM 0 comments · Email This BlogThis! ...
      bursakerja.sman1ngunut.info/2010_07_01_archive.html - Cached
      Wijaya-karya-surabaya - Lowongan Kerja Terbaru
       - [ Translate this page ]
      About PT Wijaya Karya wika co id A state owned enterprise involved in ... Related : Wika co id Site Info. PT Wijaya Karya Persero Tbk WIKA JK People Reuters ...
      Peluang usaha pakaian anak brendit murah Great A - Bayi - Forum ...
       - [ Translate this page ]
      11 posts - 9 authors - Last post: 22 Apr 2007
      halo mba cika... aku jg mau dong katalognya email cucu@wika.co.id. sherly 6/8/2007 9:11:00 AM. hallo mbak cika. ...
      ip52-141.cbn.net.id/forum/forum_detail.asp?catid=&pg=3... - Cached
      Get more discussion results
      Pengadaan Barang Pt Wika
       - [ Translate this page ]
      5 Okt 2010 ... PANDUAN PENERAPAN GOOD CORPORATE GOVERNANCE - WIKA.CO.ID KEMENTERIAN BUMN Pengadaan Barang dan Jasa; Kerjasama; Lelang Aset; Lowongan; ...
      www.informasikarir.com/var/pengadaan+barang+pt+wika - Cached
      Data Alumni Teknik UNSOED | Facebook
       - [ Translate this page ]
      TTL : Purbalingga, 6 Maret 1985. Studi : Teknik Sipil Angkatan : 2003. Email: yudhistira_down@yahoo.com, yudhistira@wika.co.id. about 8 months ago ...
      www.facebook.com/topic.php?uid=194980637859&topic... - Cached
      Indo Bokep 3gp Wen Ru Pdf Word Free Ebooks Download - Update ...
       - [ Translate this page ]
      Download your ... http://www.wika.co.id/.../download/Indo construction sector full 080904.pdf ... Related Searches: » indo bokep 3gp wen ru » . ...
      news.free4house.com/.../indo+bokep+3gp+wen+ru+pdf+word+free+ebooks+download - Cached
      laporan keuangan manulife PDF
       - [ Translate this page ]
      Dana Pensiun Lembaga Keuangan (DPLK) Manulife . Iuran karyawan di tetapkan 5% dari 1 ... http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      pdf.hulufile.com/laporan-keuangan-manulife-page3.html - Cached
      PT Bank Rakyat Indonesia (Persero) Tbk, Banking Companies ...
       - [ Translate this page ]
      www.wika.co.id. [WTB] $24 Innovative logo Contest. Forum Management. vBulletin; Google Sitemaps; Web Hosting The firm will be involved in the business of ...
      ... http://www.pu.go.id/ http://www.wika.co.id/ http://www.waskita.co.id/ http://www.trakindo.co.id/ http://www.indocement.co.id/ http://www.asi.or.id/ ...
      disdik.bogorkab.go.id/index.php?option=com_easybook...5 - Cached
      Free download pdf: kas dan piutang
       - [ Translate this page ]
      Kas dan setara kas mencakup kas, bank dan investasi jangka ... 2005 tentang pembentukan penyisihan piutang ragu-ragu dengan kriteria ... www.wika.co.id ...
      www.2dix.com/pdf/kas-dan-piutang-pdf.php - Cached
      December 2009 Belajar - Internet, Sistem, Informasi, Tutorial, Web ...
       - [ Translate this page ]
      PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi PT Indah Karya http://www.indahkarya.com ...
      adegustiann.blogsome.com/2009/12/ - Indonesia - Cached
      Belajar - Internet, Sistem, Informasi, Tutorial, Web, Blog, Seo ...
       - [ Translate this page ]
      PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi PT Indah Karya http://www.indahkarya.com ...
      adegustiann.blogsome.com/category/alamat-situs/ - Indonesia - Cached
      Superindo Co Id Whois Lookup Whois - Lirik Lagu Indonesia Terbaru
       - [ Translate this page ]
      http://rbls.org/portal.wika.co.id. http://rbls.org/ebilgames.com. http://rbls.org/ http://rbls.org/akinator.com. ...
      liriklaguterbaru.com/search/superindo+co+id+whois+lookup+whois - Cached
      ARWD » HotStockCafe
      PT Wika Realty (www.wika.co.id/eng/) is a fully integrated land and infrastructure builder/developer recently listed in the Jakarta Stock Exchange (JSX). ...
      www.hotstockcafe.com/blog/?page_id=1448 - Cached
      Wika NGK Insulators PT | Yellow Pages
       - [ Translate this page ]
      Fax, : 021 2522560. Website, : http://wika.co.id/wkngk. Average: 0. Your rating: None. Your rating 0 Average 0 (0 vote). Share/Save · Claim as your business ...
      www.yellowpages.co.id/wika-ngk-insulators-pt/listrik.../299318 - Cached
      Wika NGK Insulators PT | Yellow Pages
       - [ Translate this page ]
      CIBINONG 16820. Phone, : 021 8674034 - 021 8674035 - 021 8675643 - 021 86861258. Fax, : 021 8674035 - 021 86861507. Website, : http://wika.co.id/wkngk ...
      www.yellowpages.co.id/en/wika-ngk-insulators-pt/.../818762?tab... - Cached
      Review Perusahaan yang menerapkan KMS
       - [ Translate this page ]
      Portal Wika (www.wika.co.id) Sebagai tindak lanjut dan komitmen WIKA menerapkan KM dalam organisasi perusahaan, maka pada tanggal 18 Agustus 2005 ...
      www.scribd.com/doc/.../Review-Perusahaan-yang-menerapkan-KMS - Cached
      laporan keuangan(neraca,laba rugi,arus kas dan perubahan modal ...
       - [ Translate this page ]
      5 Sep 2010 ... http://www.wika.co.id/data/specialfeatures/CodeofCG.pdf; LAPORAN AUDITOR INDEPENDEN rugi, laporan perubahan ekuitas, dan laporan arus kas ...
      www.sz-pet.com/laporan-keuangan(neraca,laba-rugi,arus-kas-dan-perubahan-modal).html - United States - Cached
      DEN JASA 00-44-13 Banda Aceh - www.henjai.com
       - [ Translate this page ]
      7 Jun 2008 ... PT PLN (Persero) Pikitring Jawa, Bali dan Nusa WIKA and Sahid Group Held the Topping Off Of Sahid Sahirman Memorial Hospital. www.wika.co.id ...
      City Directory - Urbanesia.com - www.henjai.com
       - [ Translate this page ]
      Fly Over - Jakarta • Cibubur Flyover WIKA Berpartisipasi dalam Turnamen Golf HUT AKI 2006 Company 2007&quot; • WIKA's Housing. www.wika.co.id ...
      Arifin - Pipl Profiles
       - [ Translate this page ]
      Kirim Lamaran & CV + foto terbaru via Email ke : anang.arifin@ wika.co.id ... [ bursa-karir.com ]. Wijaya Karya,Lowongan Kerja,syarat,adi,WIKA,PT Wijaya, ...
      pipl.com/directory/name/Arifin/440 - United States
      Pandu Anugrah - Pipl Profiles
       - [ Translate this page ]
      [ www.wika.co.id ]. UR,Bahana Securities,co.id,Adaro,Chg,IDR,expenses, Pandu Anugrah. ... [ www.wika.co.id ]. Dwi,Putra,Eko,Wahyu,Adi,Agus,Moch,Angga, ...
      pipl.com/directory/name/Anugrah/Pandu - United States
      Lap Tahun 2008 PDF @ PDFWindows.Com
       - [ Translate this page ]
      ... yang berakhir tanggal 31 Maret 2008 dan 2007 ... Download. Source: http://www.wika.co.id/data/specialfeatures/LAP%2520WIKA%2520KW%25201%25202008.pdf ...
      www.pdfwindows.com/ebook/lap+tahun+2008.html - Cached
      laporan keuangan manufaktur 2008 2009 ebook books Download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/LAPKEU%20MARET%202009%20-%20REVISED.pdf. mdkey: c5643d1cb47c13278de9bbbe4db29ffc ...
      www.edu-doc.com/index.php?q=laporan+keuangan...2008... - Cached
      bahana ebook books Download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Bahana%2010%20Juni%202010.pdf. mdkey: 4a0b3fc278cfe9ea5688df82b468958b. Bahana Daily · Download. andhika@bahana.co.id ...
      www.edu-doc.com/index.php?q=bahana - Cached
      Daftar Website Indonesia
       - [ Translate this page ]
      22 Jun 2010... Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, Tangerang and Bekasi ... http://www.wika.co.id ...
      proxy.caw2.com/index.php?vit=uggc%3A%2F%2Fqnsgnejro... - Cached
      :: Wartakotalive.com | Berita : Batal, Uji Coba Gardu Tol Miring
       - [ Translate this page ]
      24 Mei 2010 ... wika.co.id. Dibaca : 205 kali | Komentar: 0. Jakarta, Warta Kota. PT Jasa Marga (Persero) Tbk membatalkan rencana uji coba Gerbang Tol (GT) ...
      www.wartakota.co.id/detil/berita/.../Batal-Uji-Coba-Gardu-Tol-Miring - Cached
      Daftar Lembaga Donor (BUMN)
       - [ Translate this page ]
      Website: www.wika.co.id 10. PT. Wasikta Karya Waskita Building, 4th floor Jl. MT. Haryono No. 10 Jakarta 13340 Telp. 021-570 8070. Fax . 021-570 8070 ...
      fabanyu.blogspot.com/.../daftar-lembaga-donor-bumn.html - Cached - Similar
      Hutama Karya - People / info about name Hutama Karya - yasni.co.uk ...
       - [ Translate this page ]
      The MOU was signed by PT Wijaya Karya, PT Hutama Karya, PT Adhi Karya, PT Pembangunan Perumahan, PT Waskita Karya, PT Indah Karya, … www.wika.co.id ...
      berita8.com - Konsultasi Gratis Dari Feri Purwo - INFO AKSES ...
      ... http://www.yellowpag es.com/ http://www.yellowpag es.co.id/ http://www.pu.go.id/ http://www.wika.co.i d/ http://www.waskita.c o.id/ http://www.trakindo. ...
      www.berita8.com/lihatkonsultasi.php?id=389 - Cached
      PSAK 25 ppt~3 - Find-Docs.com - Free Documents Search Engine
       - [ Translate this page ]
      view - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1... download - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1. ...
      www.find-docs.com/PSAK-25-ppt~3.html - Cached
      arus kas ppt~9 - Find-Docs.com - Free Documents Search Engine
       - [ Translate this page ]
      view - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1... download - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1. ...
      www.find-docs.com/arus-kas-ppt~9.html - Cached
      Pt Kai Commuter Jabodetabek | Info Lowongan Kerja Terbaru Perusahaan
       - [ Translate this page ]
      http://www.wika.co.id/eng/invesrel/index.php?act=detailnews&p_id=288 .... For constructing PT KAI Commuter Jabodetabek, PT Indonesian Train ...
      Index Harga Bahan Bangunan Jakarta (verified) - .pdf | Info ...
       - [ Translate this page ]
      http://www.pdfqueen.com/harga-material-bangunan-2010 .... ... harga material bahan bangunan... http://www.wika.co.id/data/download/Samuel Sekuritas 7 juli ...
      lowongankerjamu.info/.../index%20harga%20bahan%20bangunan%20jakarta%20(verified)%... - Cached
      Search Results for LAPORAN KEUANGAN BANK BNI TAHUN 2008 2009 2010 ...
       - [ Translate this page ]
      http://www.wika.co.id/data/specialfeatures/prospectus.pdf. 0 Vote Up Vote Down 0. Loading... Download! ESP Quarterly Report No.8 Jan-Mar 07 ...
      demos.aioshared.com/.../Laporan%20Keuangan%20Bank%20BNI%20tahun%202008%2020... - Cached
      Konstruksi dan Pemeliharaan « Bisnis | Daftar Website Indonesia ...
       - [ Translate this page ]
      ... macam macam bahan kontruksi, macam-macam bahan konstruksi, www wika co id, bahan baku konstruksi, model rumah kontr, GAMBAR SKETSA FRONT OFFICE HOTEL, ...
      daftarweb.org/Bisnis/Konstruksi_dan_Pemeliharaan?p=2 - Indonesia - Cached
      Ipp Medan Ac Id
       - [ Translate this page ]
      lowongankerjamu.com/dir/ipp+medan+ac+id - Cached
      Sukses Melamar Pekerjaan Lewat Internet - Google Books Result
      Jarot Setyaji
      hilman86 » Knoledge Management
       - [ Translate this page ]
      14 Jun 2009 ... http://www.wika.co.id/wikaweb/eng/invesrel/index.php?act=detailnews&p_id=72. KM yang dapat di petik : WIKA sebagai salah satu perusahaan ...
      hilman86.blog.binusian.org/category/knoledge-management/ - Cached
      Nothing found for Wijaya Karya (WIKA)
       - [ Translate this page ]
      JK/WIKA IJ - Rp365) - BUY Result Visit our website at www.trimegah. com WIKA booked strong ... http://www.wika.co.id/data/download/Trimegah%2013may.pdf ...
      www.pdfdownloadforfree.com/Wijaya-Karya-(WIKA).html - Cached
      Daftar lokasi dengan kategori BUMN
       - [ Translate this page ]
      Peta -http://www.wika.co.id/ · Jasa Marga, PT Tbk Kebon Nanas Kategori: BUMN Alamat: Jl. Mh Thamrin, Kebon Nanas. Peta -http://www.jasamarga.com/ ...
      bukukuning.detik.com/kategori/kantor/subkategori/bumn - Cached
      Telecharger Microsoft Word jadwal PDF - Pdf gratuit
       - [ Translate this page ]
      Archive: http://www.wika.co.id/data/specialfeatures/JADWAL%20KEGIATAN%20MANAGEMENT%20TRAINEE%20ANGKATAN%2026.pdf 21-25 Juni 2010. 08.00 – Selesai. ...
      www.articlesgt.com/pdf-Microsoft-Word---jadwal/ - Cached
      Kawanlama.com: #1 Industrial Supply Company - Kawan Lama Sejahtera
       - [ Translate this page ]
      24 Nov 2009 ... Related Sites: Indoneem.com , Aristirta.com , Aggio.com , Dino.co.id , Tropika-rattan.co.id , Wika.co.id , Megasetia.com , Adk.co.id ...
      dawhois.com/site/kawanlama.com.html - Cached - Similar
  73. [PDF]
      PT WIJAYA KARYA (Persero) Tbk.
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      19 Jan 2010 ... Natal Argawan Pardede. Corporate Secretary. Ph. 6221-8192808 / 08111988685. Faks. 6221-85911969. Email, natal. argawan@wika. co. id.
      www.idx.co.id/.../685DA3AF-4163-4141-87D8-F3BFE3704715.PDF - Similar
      iMuL's Virtual Home - Karya Pemenang Ke-2 Kisah Seru di - www ...
       - [ Translate this page ]
      29 Sep 2010 ... www.wika.co.id. Browse by Subject - PSAS IR. Abdul Ran, Mohd Zariat (2007) Bacaan Hermeneutik Terhadap Karya Perang A. Samad Said. ...
      analisis efektifitas dan efisiensi terhadap return harga saham ppt ...
       - [ Translate this page ]
      18 Okt 2010 ... 9. http://learningcenter.wika.co.id/FILES/eureka_page... ppt description: Eskalasi harga (penyesuaian harga komponen biaya konstruksi selama ...
      www.linkpdf.com/.../analisis-efektifitas-dan-efisiensi-terhadap-return-harga-saham-.ppt - Cached
      piutang usaha ppt - Free Download Ebook PDF Search Engine Makalah ...
       - [ Translate this page ]
      6. http://learningcenter.wika.co.id/FILES/eureka_page... ppt description: Beban Penyisihan Piutang; Alokasi Beban Usaha dan Beban Proyek . ...
      www.linkpdf.com/download/3-dl/piutang-usaha-.ppt - Cached
      harga plastik - eBook Downloads
       - [ Translate this page ]
      ... (pabrik metal untuk spare part kendaraan, tangki elpiji dan plastik ... www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf - View ...
      pdfcatch.net/ebook/harga+plastik/ - Cached
      Sucipto Cipto - People / info about name Sucipto Cipto - yasni.com ...
       - [ Translate this page ]
      Tags on Sucipto Cipto: Indonesia, Blogger, Jl.Kyai Adnan, Surabaya, Phone Number, Owner/Entrepreneur, Suwawal Timur, Cipto[at]wika.co.id, Iklan, Address.
      www.yasni.com/sucipto+cipto/check+people - United States
      akden_wika : Message: Re: [akden_wika] Droping Minggu II Juni 2010 ...
       - [ Translate this page ]
      6 posts - 2 authors - Last post: 17 Jun
      If you need Clarification or have received this communication error please notify us immediately by responding to adwijaya@wika.co.id ...
      finance.groups.yahoo.com/group/akden_wika/message/222 - Cached
      Get more discussion results
      PT Wijaya Karya » Info Lowongan Kerja
       - [ Translate this page ]
      17 Okt 2006 ... source: wika.co.id. Join our newsletter to receive job vacancy info lowongan pekerjaan via email, click here ...
      lowongankerja.blogpico.com/2006/10/17/pt-wijaya-karya/ - Cached
      Angkasa Pura Ii Soekarno Hatta | PDF Finder | PDF Search Engine
       - [ Translate this page ]
      ... Pura II PT Angkasa Pura II ... http://www.wika.co.id/data/download/WIKA%207%20September%202009%20(%20Pandu%20Anugrah%20-%20Bahana%20Securities).pdf ...
      www.pdf-finder.com/pdf/angkasa-pura-ii-soekarno-hatta.html - Cached
      Situs Informasi Perpajakan Bagi Profesional - www.bobbang.com
       - [ Translate this page ]
      www.wika.co.id. PT BANK RAKYAT INDONESIA (PERSERO) Tbk DAN ANAK PERUSAHAAN. Tagihan wesel ekspor adalah wesel ekspor yang dinegosiasikan secara diskonto dan ...
      TestCompany mail: RE: [obrolan-bandar] Ask Info: IPO Sat NusaPersada
       - [ Translate this page ]
      .(baca profil perusahaan WIKA di www.wika.co.id). Salam,. Rudy. From: obrolan-bandar(*)yahoogroups.com [mailto:obrolan-bandar(*)yahoogroups.com] On Behalf ...
      www.testcompany.com/archive/October2007-42/4658.html - Cached
      PP:Home - www.sinzub.com
       - [ Translate this page ]
      24 Agu 2010 ... www.wika.co.id/data/specialfeatures/Laporan keuangan Q2 2010.pdf ... International. A world. www.wika.co.id. MEDIA PENILAI INTERNAL ...
      Situs Resmi Pemerintah Kabupaten Klungkung
       - [ Translate this page ]
      ... Http://www.yellowpages.com Http://www.yellowpages.co.id Http://www.pu.go.id Http://www.wika.co.id Http://www.waskita.co.id Http://www.trakindo.co.id ...
      www.klungkungkab.go.id/main.php/webmail/gsp/?go=kritik... - Cached
      Pengendalian Risiko Lingkungan Di Kantor Kesehatan pdf document, ebook
       - [ Translate this page ]
      ... pelaksanaan kesehatan dan keselamatan kerja. M. Pengelolaan Lingkungan PT ... http://www.wika.co.id/data/specialfeatures/CODE%20OF%20CONDUCT%202009.pdf ...
      ebookpedia.net/.../pengendalian-risiko-lingkungan-di-kantor-kesehatan.html - United States - Cached
      Arsip UA - www.aseanmusic.com
       - [ Translate this page ]
      13 Mar 2009 ... www.wika.co.id. Setelah Pabrik Dikuasai Tentara. Itu sebabnya, PT Amerin Abdi kini memerkarakan kesewenang-wenangan itu ke Pengadilan Wira ...
      WebMii - Marga Tama
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Projected%20Invesment%202008.pdf. Display all results. Alexander's Gas & Oil Connections - Indonesia and Malaysia . ...
      www.webmii.es/Result.aspx/Marga/Tama - Cached
       - [ Translate this page ]
      Dalam persen | In ... pembangkit tenaga listrik dan industri berat. Spesialisasi ini sangat diperlukan oleh ... www.wika.co.id | View PDF | Download PDF ...
      www.pdf.kq5.org/search/logam+berat+imbal - Cached
      Conservation International Wikipedia Bahasa Indonesia - Low Diet ...
       - [ Translate this page ]
      ... 2005 ... belum tersedia dalam Bahasa Indonesia - not yet available in Indonesian. ... with the Indonesian contractor PT Wijaya Karya at www.wika.co.id), ...
      www.lowdietonline.com/.../conservation+international+wikipedia+bahasa+indonesia - United States - Cached
      Katalog Produk: Logo Design - Bee Creative - Indonesia
       - [ Translate this page ]
      E-mail: grafis@wika.co.id. Nomer HP: 0813 15887089. Nomer Telpon: 6221-94522402. Nomer Faks: 6221-8191235. Alamat: Gedung WIKA Jl. DI. Panjaitan Kav.9 ...
      beecreative.indonetwork.co.id/1768314/logo-design.htm - Cached
      fizziedotcom.blogspot.com - www.wunwan.com
       - [ Translate this page ]
      29 Okt 2008 ... Pipeline as of May 2008 (in billion Rp) Source: Company. www.wika.co.id. Surat Perjanjian (Kontrak) Kerja Jasa Konsultansi | INKINDO ...
      Permana Jayawirya Bani Dipa - Silahkan Kunjungi....
       - [ Translate this page ]
      Posted on Nov 15, '07 11:37 PM for everyone, wika.co.id, 6. Link, Semua Tentang CAD Posted on Nov 14, '07 9:07 PM for everyone ...
      permanajayawirya.multiply.com/links - Cached
      Ayo gabung di milis masalah psikologi bayi - Bayi - Forum Diskusi ...
       - [ Translate this page ]
      11 posts - 10 authors - Last post: 26 Dec 2005
      add aku ya di melanie@wika.co.id. Thx. Shinta Devi 12/15/2006 5:44:00 PM. ikutan dong... emailku devimachmud@yahoo.com. Nita Novianti ...
      www.parenting.co.id/forum/forum_detail.asp?catid=&pg... - Cached
      Get more discussion results
      List of results for: `revisi tahun 2009`. Download and read the ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA_0501_SeI_Sektor Prospektif di Tahun 2009.pdf. Tags: WIKA , 0501 , SeI , Sektor , Prospektif , Tahun , 2009pdf ...
      www.hqpdf.com/list/key+revisi+tahun+2009 - Cached
      [ac-i] Lomba Tulis dan Foto utk Jurnalis
       - [ Translate this page ]
      20 Des 2009 ... wika.co.id - identitas penulis dicantumkan di belakang amplop atau di dalam email - pengiriman artikel dari tanggal 20 Desember 2009 sampai ...
      www.mail-archive.com/artculture...com/msg04636.html - Cached - Similar
      PT Wijaya Karya (Persero)
       - [ Translate this page ]
      26 Jul 2010 ... via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. Feedjit Live Blog Stats ...
      cdcumy.blogspot.com/2010/07/pt-wijaya-karya-persero.html - Cached
      PT Wijaya Karya
       - [ Translate this page ]
      20 posts - 15 authors - Last post: 2 Sep
      PT Wijaya Karya (Persero) Tbk planted 1.000 mangroves in Pasanggrahan Bali (4/6). ... www.wika.co.id - Cache. Link to external site ...
      companydatabase.org/search.php?rt=more&st=PT+Wijaya... - Cached
      Get more discussion results
      LP3I LAMPUNG | Facebook
       - [ Translate this page ]
      Lamaran lengkap dikirim melalui email: erik@wika.co.id. Trims. 16. februar kl. 17:42 · Kommenter · Lik dette · Rapporter ...
      nn-no.facebook.com/group.php?gid=78485732787&v... - Norway - Cached
      sman3bdg86 : Message: Re: [sman3bdg86] Fwd: AIR SEMBAHYANG
       - [ Translate this page ]
      28 posts - 6 authors - Last post: 2 Nov 2009
      denden<denfazri@yahoo.com>; deni<deni.armand@wika.co.id>; Destinia Jenialita<jenialita@yahoo.ca>; Dini Ganda May<aganda@slingshot.co.nz>; ...
      groups.yahoo.com/group/sman3bdg86/message/2033 - Cached
      Get more discussion results

    * Everything

    * Images
    * Videos
    * News
    * Books
    * Places
    * Blogs
    * Updates
    * Discussions


    * Kuala Lumpur, Federal Territory of Kuala Lumpur

    * Auto-detected

Change locationClose
Search Options

    *Search settings | Sign in
Advanced search
Page 3 of about 29,400 results (0.13 seconds) 
Search Results

      Complete List of Indonesian Company | Indonesia Associate
       - [ Translate this page ]
      http://www.wika.co.id http://www.enseval.com. NA http://www.jababeka.com http://www.cmnp.co.id http://www.bhakti-investama.com http://www.acehardware.co.id/ ...
      www.indonesiaassociate.com/.../complete-list-of-indonesian-company.html - Cached
      Rev Edit Ar Wika Ok - Petrochemical Oil Jobs
       - [ Translate this page ]
      Hadori & Rekan. HLB ... Source :http://www.wika.co.id/data/specialfeatures/AnnualReport2007.pdf. Thanks site is goodpczypc ...
      www.petrochemicaloiljobs.com/jobsearch/rev+edit+ar+wika+ok - Cached
      Leading Company Pt Wijaya Karya - Petrochemical Oil Jobs
       - [ Translate this page ]
      PT Wijaya Karya (Persero) Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, ... Source :http://www.wika.co.id/ ...
      www.petrochemicaloiljobs.com/.../leading+company+pt+wijaya+karya - Cached
      2009 In Pelabuhan Ratu pdf documents | ebooks library download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/W... Preview pdf of Microsoft Word - WIKA CG Q2 2009 ver 2.3 · Microsoft Word - WIKA CG Q2 2009 ver 2.3 free download ...
      www.ebooklibs.com/2009_in_pelabuhan_ratu.html - Cached
      IP 201 456 71 47920 121 0 179 http://piwik.org/faq/general/#faq_52 ...
      ... 365 77 28632 110 0 160 http://www.telkom.net.id/ Fast 5 11 10 1557 3 0 5 http://www.fast.net.id/ Wika 3 3 2 30 3 0 2 http://www.wika.co.id/ Blackberry 3 ...
      pregool.com/piwik/?module=API&method...1... - Cached
      Samepoint Social Conversation Search wika | Groups
       - [ Translate this page ]
      Gw rasa Prospek wika (Wijaya Karya) kedepanya bagus. sekarang wika dah banyak ikut tender ... bener gan situsnya www.wika.co.id. kalau da bukan buat ...
      www.samepoint.com/groups.php?q=wika - United States - Cached
      Samepoint Social Conversation Search adji kurniawan | page 5 of ...
       - [ Translate this page ]
      Negatives Words: (None found in this post) | + Positive Words: (None found in this post). Tweet - Original on: wika.co.id - Search this source ...
      www.samepoint.com/docs.php?page=5&q=adji... - United States - Cached
      trimegah securities PDF Download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/30Jul09,%20WIKA,%20Better-than-Expected%201H09%20on%20Buoyant%20Margins%20(Stanley%20Tjiandra%20-%20Trimegah%20Sec).pdf ...
      www.book925.com/trimegah-securities-pdf.html - Cached
       - [ Translate this page ]
      WEB Add : www.wika.co.id. No. NPWP : 01.001.615.2-051.000 begin_of_the_skype_highlighting              001.615.2-051.000      end_of_the_skype_highlighting. No. SIUP/TDUP : 04657/1.824.271 (Tgl : 21-07-2008) No Anggota KADIN : 00120 ...
      www.jakartacci.com/webpages/bsk/listing/jt/30185.htm - Cached
      Laporan Keuangan 31 Desember 2008 Pt Bank Syariah Bukopin Pdf ...
       - [ Translate this page ]
      by: http://www.wika.co.id/data/download/Laporan%2520Keuangan%2520Konsolidasi%252031%2520Des%252008%2520Audited%2520%2B%2520Catatan%2520atas%2520Laporan% ...
      muizzaddin.com/?s=laporan+keuangan+31...pt... - Indonesia - Cached
      Get Domain Name Ip Address pkbl.bumn.go.id; Whois Lookup For go.id
       - [ Translate this page ]
      www.wika.co.id · Whois domain registration for www.wika.co.id whois. Indonesia's Leading Integrated EPC & Investment Company construction bumn company of ...
      domainsbyip.com/domaintoip/pkbl.bumn.go.id/ - Cached
      Laporan Segmen Triwulan Perusahaan .pdf Download
       - [ Translate this page ]
      ... tiap segmen berdasarkan bidang usaha. Perusahaan menerapkan ... http://www.wika.co.id/data/download/LAPKEU MARET 2009 - REVISED.pdf; Preview Maximize ...
      www.pdfph.com/pdf/laporan-segmen-triwulan-perusahaan/ - Cached
      Contoh Laporan Keuangan Perusahaan Jasa Konstruksi .pdf Download
       - [ Translate this page ]
      Pada laporan keuangan per 31 Desember 2008, Perusahaan belum menerapkan ketentuan ... http://www.wika.co.id/data/download/Laporan Keuangan Konsolidasi 31 ...
      www.pdfph.com/.../contoh-laporan-keuangan-perusahaan-jasa-konstruksi/ - Cached
      Leading Company Pt Wijaya Karya Iklan Baris Pendidikan @Kopertis2.Org
       - [ Translate this page ]
      Leading Company PT Wijaya Karya. WIKA Provides Amounts Of Information That Would Be Important To An Investor Making An Investment from wika.co.id ...
      kopertis2.org/education/leading_company__pt_wijaya_karya.html - Cached
      Kepemilikan Minoritas - JEVUSKA
       - [ Translate this page ]
      ... tidak lancar 764305983092 738336597236 hak kepemilikan minoritas dalam anak. Source: http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      www.jevuska.com/topic/kepemilikan+minoritas.html - Indonesia - Cached
      Wijaya Karya Tbk, PT | Jakarta, Indonesia | Company Profile ...
       - [ Translate this page ]
      ()62 021 819-2808, 62 021 819-1235 fax, http://www.wika.co.id. Primary SIC: Land Subdividers & Developers, Not Elsewhere Classified, ...
      goliath.ecnext.com/.../product-compint-0001377509-page.html - Cached - Similar
      Tabung Elpiji Vektor | fictivedesign.com
       - [ Translate this page ]
      Download your favorite logo elpiji vektor at wika.co.id//download/WIKA_0724_IDI_WIKA Akan Naikan Kapasitas Produksi Tabung Elpiji.pdf ...
      fictivedesign.com/search/tabung+elpiji+vektor - Cached
      Bahana Daily - www.dosiwa.com
       - [ Translate this page ]
      4 Sep 2010 ... Source: Company. Expanding beyond traditional Heri Sunaryadi. President Director. ext 3000. heri@bahana.co.id. Research. www.wika.co.id ...
      Yusup Persat Sembiring - Portfolio on BrightFuse - A Talent - www ...
       - [ Translate this page ]
      www.wika.co.id. Banyu Urip Project | PT. LISA CONCRETE INDONESIA. Facade Proyek PLTU PAITON; RC BOX CULVERT di Menur; Rivetment di Jawa Tengah Atasi Banjir, ...
      company update microsoft powerpoint company update 2009 pdf - Free ...
      2009 : - Perubahan PT CIP menjadi PT WIKA Insan Pertiwi ... Investment Company in South East Asia ... http://www.wika.co.id/data/download/Company Update.pdf ...
      www.ebookf.com/.../company-update-microsoft-powerpoint-company-update-2009-book.pdf - Cached
      hubungan dengan pihak istimewa pdf - Free unlimited eBook search ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Laporan Keuangan Konsolidasi 31 Des 08 Audited Catatan atas Laporan Keuangan - PT Wijaya Karya (Persero) Tbk.pdf ...
      www.ebookf.com/hu/hubungan-dengan-pihak-istimewa-book.pdf - Cached
      BUY Adhi Karya | PDFGirl | PDF Search Engine
       - [ Translate this page ]
      ... 294 6 0.18 17.3 1.4 26.5 Adhi Karya Indonesia 94 485 0.05 4.6 1.0 2.7 Wijaya Karya ... http://www.wika.co.id/data/download/Bahana%2010%20Juni%202010.pdf ...
      www.pdfchaser.com/pdf/BUY-Adhi-Karya.html - Cached
       - [ Translate this page ]
      ... unicorporated PT Wijaya Karya (Persero) Tbk (IDX issuer code: WIKA), Tsukishima Kikai Co. Ltd and PT Nusantara Energi Abadi ... http://www.wika.co.id ...
      Pt Pln » maxall's blog
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA_Release_GroundBreaking_PLTU_TanjungPriok_ver.1.3_webeng.pdf. Karaha Bodas and Himpurna arbitrations ...
      maxall.web.id/berita/pt-pln.html - Cached
      bernardo@a_paris dontask@bitch.net bilotta@domain.com.br ...
      COM adwijaya@wika.co.id cyhii@tm.net.my sakt@hotmail.com jdean@rogers.wave.ca vajdam@ny.bgytf.hu VivaEP@aol.com rohjk@wincomsoft.com okul_0kul@hotmail.com ...
      Business &amp; Financial News, Breaking US &amp; International ...
       - [ Translate this page ]
      Leading Company - PT Wijaya Karya. • Mahkota Inti Citra • Ministry of Regional Infrastructure Indofood Sukses Makmur • Ericsson •. www.wika.co.id ...
      PT Indocards Sukses Makmur - www.sungkom.com
       - [ Translate this page ]
      21 Jul 2010 ... Civil Foundation for Baby food Factory-Sukabumi : PT. Indofood Sukses Makmur : 22,5 B : 2003 - 2004. www.wika.co.id ...
      manajemen piutang Pdf
       - [ Translate this page ]
      ... saldo akun piutang usaha pada akhir tahun, manajemen. Perusahaan berpendapat bahwa jumlah penyisihan piutang www.wika.co.id - View - Download ...
      bukubaru.net/manajemen-piutang.html - Cached
      penerimaan pegawai pt pelabuhan indonesia i persero bursa kerja Pdf
       - [ Translate this page ]
      ... penerimaan sampai dengan tahun 2006, untuk pegawai .. Bank Rakyat Indonesia (Persero). 2084067594. PT. Bank Jawa Barat www.wika.co.id - View - Download ...
      bukubaru.net/penerimaan-pegawai-pt-pelabuhan-indonesia-i-persero-bursa-kerja.html - Cached
      July 2010
       - [ Translate this page ]
      pramusinto@wika.co.id Atau novita@wika.co.id. Posted by Komunitas Blogger Indonesia at 8:25 PM 0 comments · Email This BlogThis! ...
      bursakerja.sman1ngunut.info/2010_07_01_archive.html - Cached
      Wijaya-karya-surabaya - Lowongan Kerja Terbaru
       - [ Translate this page ]
      About PT Wijaya Karya wika co id A state owned enterprise involved in ... Related : Wika co id Site Info. PT Wijaya Karya Persero Tbk WIKA JK People Reuters ...
      Peluang usaha pakaian anak brendit murah Great A - Bayi - Forum ...
       - [ Translate this page ]
      11 posts - 9 authors - Last post: 22 Apr 2007
      halo mba cika... aku jg mau dong katalognya email cucu@wika.co.id. sherly 6/8/2007 9:11:00 AM. hallo mbak cika. ...
      ip52-141.cbn.net.id/forum/forum_detail.asp?catid=&pg=3... - Cached
      Get more discussion results
      Pengadaan Barang Pt Wika
       - [ Translate this page ]
      5 Okt 2010 ... PANDUAN PENERAPAN GOOD CORPORATE GOVERNANCE - WIKA.CO.ID KEMENTERIAN BUMN Pengadaan Barang dan Jasa; Kerjasama; Lelang Aset; Lowongan; ...
      www.informasikarir.com/var/pengadaan+barang+pt+wika - Cached
      Data Alumni Teknik UNSOED | Facebook
       - [ Translate this page ]
      TTL : Purbalingga, 6 Maret 1985. Studi : Teknik Sipil Angkatan : 2003. Email: yudhistira_down@yahoo.com, yudhistira@wika.co.id. about 8 months ago ...
      www.facebook.com/topic.php?uid=194980637859&topic... - Cached
      Indo Bokep 3gp Wen Ru Pdf Word Free Ebooks Download - Update ...
       - [ Translate this page ]
      Download your ... http://www.wika.co.id/.../download/Indo construction sector full 080904.pdf ... Related Searches: » indo bokep 3gp wen ru » . ...
      news.free4house.com/.../indo+bokep+3gp+wen+ru+pdf+word+free+ebooks+download - Cached
      laporan keuangan manulife PDF
       - [ Translate this page ]
      Dana Pensiun Lembaga Keuangan (DPLK) Manulife . Iuran karyawan di tetapkan 5% dari 1 ... http://www.wika.co.id/data/specialfeatures/WIKA%20Q2%202009.pdf ...
      pdf.hulufile.com/laporan-keuangan-manulife-page3.html - Cached
      PT Bank Rakyat Indonesia (Persero) Tbk, Banking Companies ...
       - [ Translate this page ]
      www.wika.co.id. [WTB] $24 Innovative logo Contest. Forum Management. vBulletin; Google Sitemaps; Web Hosting The firm will be involved in the business of ...
      ... http://www.pu.go.id/ http://www.wika.co.id/ http://www.waskita.co.id/ http://www.trakindo.co.id/ http://www.indocement.co.id/ http://www.asi.or.id/ ...
      disdik.bogorkab.go.id/index.php?option=com_easybook...5 - Cached
      Free download pdf: kas dan piutang
       - [ Translate this page ]
      Kas dan setara kas mencakup kas, bank dan investasi jangka ... 2005 tentang pembentukan penyisihan piutang ragu-ragu dengan kriteria ... www.wika.co.id ...
      www.2dix.com/pdf/kas-dan-piutang-pdf.php - Cached
      December 2009 Belajar - Internet, Sistem, Informasi, Tutorial, Web ...
       - [ Translate this page ]
      PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi PT Indah Karya http://www.indahkarya.com ...
      adegustiann.blogsome.com/2009/12/ - Indonesia - Cached
      Belajar - Internet, Sistem, Informasi, Tutorial, Web, Blog, Seo ...
       - [ Translate this page ]
      PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi PT Indah Karya http://www.indahkarya.com ...
      adegustiann.blogsome.com/category/alamat-situs/ - Indonesia - Cached
      Superindo Co Id Whois Lookup Whois - Lirik Lagu Indonesia Terbaru
       - [ Translate this page ]
      http://rbls.org/portal.wika.co.id. http://rbls.org/ebilgames.com. http://rbls.org/ http://rbls.org/akinator.com. ...
      liriklaguterbaru.com/search/superindo+co+id+whois+lookup+whois - Cached
      ARWD » HotStockCafe
      PT Wika Realty (www.wika.co.id/eng/) is a fully integrated land and infrastructure builder/developer recently listed in the Jakarta Stock Exchange (JSX). ...
      www.hotstockcafe.com/blog/?page_id=1448 - Cached
      Wika NGK Insulators PT | Yellow Pages
       - [ Translate this page ]
      Fax, : 021 2522560. Website, : http://wika.co.id/wkngk. Average: 0. Your rating: None. Your rating 0 Average 0 (0 vote). Share/Save · Claim as your business ...
      www.yellowpages.co.id/wika-ngk-insulators-pt/listrik.../299318 - Cached
      Wika NGK Insulators PT | Yellow Pages
       - [ Translate this page ]
      CIBINONG 16820. Phone, : 021 8674034 - 021 8674035 - 021 8675643 - 021 86861258. Fax, : 021 8674035 - 021 86861507. Website, : http://wika.co.id/wkngk ...
      www.yellowpages.co.id/en/wika-ngk-insulators-pt/.../818762?tab... - Cached
      Review Perusahaan yang menerapkan KMS
       - [ Translate this page ]
      Portal Wika (www.wika.co.id) Sebagai tindak lanjut dan komitmen WIKA menerapkan KM dalam organisasi perusahaan, maka pada tanggal 18 Agustus 2005 ...
      www.scribd.com/doc/.../Review-Perusahaan-yang-menerapkan-KMS - Cached
      laporan keuangan(neraca,laba rugi,arus kas dan perubahan modal ...
       - [ Translate this page ]
      5 Sep 2010 ... http://www.wika.co.id/data/specialfeatures/CodeofCG.pdf; LAPORAN AUDITOR INDEPENDEN rugi, laporan perubahan ekuitas, dan laporan arus kas ...
      www.sz-pet.com/laporan-keuangan(neraca,laba-rugi,arus-kas-dan-perubahan-modal).html - United States - Cached
      DEN JASA 00-44-13 Banda Aceh - www.henjai.com
       - [ Translate this page ]
      7 Jun 2008 ... PT PLN (Persero) Pikitring Jawa, Bali dan Nusa WIKA and Sahid Group Held the Topping Off Of Sahid Sahirman Memorial Hospital. www.wika.co.id ...
      City Directory - Urbanesia.com - www.henjai.com
       - [ Translate this page ]
      Fly Over - Jakarta • Cibubur Flyover WIKA Berpartisipasi dalam Turnamen Golf HUT AKI 2006 Company 2007&quot; • WIKA's Housing. www.wika.co.id ...
      Arifin - Pipl Profiles
       - [ Translate this page ]
      Kirim Lamaran & CV + foto terbaru via Email ke : anang.arifin@ wika.co.id ... [ bursa-karir.com ]. Wijaya Karya,Lowongan Kerja,syarat,adi,WIKA,PT Wijaya, ...
      pipl.com/directory/name/Arifin/440 - United States
      Pandu Anugrah - Pipl Profiles
       - [ Translate this page ]
      [ www.wika.co.id ]. UR,Bahana Securities,co.id,Adaro,Chg,IDR,expenses, Pandu Anugrah. ... [ www.wika.co.id ]. Dwi,Putra,Eko,Wahyu,Adi,Agus,Moch,Angga, ...
      pipl.com/directory/name/Anugrah/Pandu - United States
      Lap Tahun 2008 PDF @ PDFWindows.Com
       - [ Translate this page ]
      ... yang berakhir tanggal 31 Maret 2008 dan 2007 ... Download. Source: http://www.wika.co.id/data/specialfeatures/LAP%2520WIKA%2520KW%25201%25202008.pdf ...
      www.pdfwindows.com/ebook/lap+tahun+2008.html - Cached
      laporan keuangan manufaktur 2008 2009 ebook books Download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/LAPKEU%20MARET%202009%20-%20REVISED.pdf. mdkey: c5643d1cb47c13278de9bbbe4db29ffc ...
      www.edu-doc.com/index.php?q=laporan+keuangan...2008... - Cached
      bahana ebook books Download
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Bahana%2010%20Juni%202010.pdf. mdkey: 4a0b3fc278cfe9ea5688df82b468958b. Bahana Daily · Download. andhika@bahana.co.id ...
      www.edu-doc.com/index.php?q=bahana - Cached
      Daftar Website Indonesia
       - [ Translate this page ]
      22 Jun 2010... Tbk cooperated with PT Pertamina (Persero) to renovate 100 schools in Bogor, Depok, Tangerang and Bekasi ... http://www.wika.co.id ...
      proxy.caw2.com/index.php?vit=uggc%3A%2F%2Fqnsgnejro... - Cached
      :: Wartakotalive.com | Berita : Batal, Uji Coba Gardu Tol Miring
       - [ Translate this page ]
      24 Mei 2010 ... wika.co.id. Dibaca : 205 kali | Komentar: 0. Jakarta, Warta Kota. PT Jasa Marga (Persero) Tbk membatalkan rencana uji coba Gerbang Tol (GT) ...
      www.wartakota.co.id/detil/berita/.../Batal-Uji-Coba-Gardu-Tol-Miring - Cached
      Daftar Lembaga Donor (BUMN)
       - [ Translate this page ]
      Website: www.wika.co.id 10. PT. Wasikta Karya Waskita Building, 4th floor Jl. MT. Haryono No. 10 Jakarta 13340 Telp. 021-570 8070. Fax . 021-570 8070 ...
      fabanyu.blogspot.com/.../daftar-lembaga-donor-bumn.html - Cached - Similar
      Hutama Karya - People / info about name Hutama Karya - yasni.co.uk ...
       - [ Translate this page ]
      The MOU was signed by PT Wijaya Karya, PT Hutama Karya, PT Adhi Karya, PT Pembangunan Perumahan, PT Waskita Karya, PT Indah Karya, … www.wika.co.id ...
      berita8.com - Konsultasi Gratis Dari Feri Purwo - INFO AKSES ...
      ... http://www.yellowpag es.com/ http://www.yellowpag es.co.id/ http://www.pu.go.id/ http://www.wika.co.i d/ http://www.waskita.c o.id/ http://www.trakindo. ...
      www.berita8.com/lihatkonsultasi.php?id=389 - Cached
      PSAK 25 ppt~3 - Find-Docs.com - Free Documents Search Engine
       - [ Translate this page ]
      view - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1... download - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1. ...
      www.find-docs.com/PSAK-25-ppt~3.html - Cached
      arus kas ppt~9 - Find-Docs.com - Free Documents Search Engine
       - [ Translate this page ]
      view - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1... download - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1. ...
      www.find-docs.com/arus-kas-ppt~9.html - Cached
      Pt Kai Commuter Jabodetabek | Info Lowongan Kerja Terbaru Perusahaan
       - [ Translate this page ]
      http://www.wika.co.id/eng/invesrel/index.php?act=detailnews&p_id=288 .... For constructing PT KAI Commuter Jabodetabek, PT Indonesian Train ...
      Index Harga Bahan Bangunan Jakarta (verified) - .pdf | Info ...
       - [ Translate this page ]
      http://www.pdfqueen.com/harga-material-bangunan-2010 .... ... harga material bahan bangunan... http://www.wika.co.id/data/download/Samuel Sekuritas 7 juli ...
      lowongankerjamu.info/.../index%20harga%20bahan%20bangunan%20jakarta%20(verified)%... - Cached
      Search Results for LAPORAN KEUANGAN BANK BNI TAHUN 2008 2009 2010 ...
       - [ Translate this page ]
      http://www.wika.co.id/data/specialfeatures/prospectus.pdf. 0 Vote Up Vote Down 0. Loading... Download! ESP Quarterly Report No.8 Jan-Mar 07 ...
      demos.aioshared.com/.../Laporan%20Keuangan%20Bank%20BNI%20tahun%202008%2020... - Cached
      Konstruksi dan Pemeliharaan « Bisnis | Daftar Website Indonesia ...
       - [ Translate this page ]
      ... macam macam bahan kontruksi, macam-macam bahan konstruksi, www wika co id, bahan baku konstruksi, model rumah kontr, GAMBAR SKETSA FRONT OFFICE HOTEL, ...
      daftarweb.org/Bisnis/Konstruksi_dan_Pemeliharaan?p=2 - Indonesia - Cached
      Ipp Medan Ac Id
       - [ Translate this page ]
      lowongankerjamu.com/dir/ipp+medan+ac+id - Cached
      Sukses Melamar Pekerjaan Lewat Internet - Google Books Result
      Jarot Setyaji
      hilman86 » Knoledge Management
       - [ Translate this page ]
      14 Jun 2009 ... http://www.wika.co.id/wikaweb/eng/invesrel/index.php?act=detailnews&p_id=72. KM yang dapat di petik : WIKA sebagai salah satu perusahaan ...
      hilman86.blog.binusian.org/category/knoledge-management/ - Cached
      Nothing found for Wijaya Karya (WIKA)
       - [ Translate this page ]
      JK/WIKA IJ - Rp365) - BUY Result Visit our website at www.trimegah. com WIKA booked strong ... http://www.wika.co.id/data/download/Trimegah%2013may.pdf ...
      www.pdfdownloadforfree.com/Wijaya-Karya-(WIKA).html - Cached
      Daftar lokasi dengan kategori BUMN
       - [ Translate this page ]
      Peta -http://www.wika.co.id/ · Jasa Marga, PT Tbk Kebon Nanas Kategori: BUMN Alamat: Jl. Mh Thamrin, Kebon Nanas. Peta -http://www.jasamarga.com/ ...
      bukukuning.detik.com/kategori/kantor/subkategori/bumn - Cached
      Telecharger Microsoft Word jadwal PDF - Pdf gratuit
       - [ Translate this page ]
      Archive: http://www.wika.co.id/data/specialfeatures/JADWAL%20KEGIATAN%20MANAGEMENT%20TRAINEE%20ANGKATAN%2026.pdf 21-25 Juni 2010. 08.00 – Selesai. ...
      www.articlesgt.com/pdf-Microsoft-Word---jadwal/ - Cached
      Kawanlama.com: #1 Industrial Supply Company - Kawan Lama Sejahtera
       - [ Translate this page ]
      24 Nov 2009 ... Related Sites: Indoneem.com , Aristirta.com , Aggio.com , Dino.co.id , Tropika-rattan.co.id , Wika.co.id , Megasetia.com , Adk.co.id ...
      dawhois.com/site/kawanlama.com.html - Cached - Similar
  73. [PDF]
      PT WIJAYA KARYA (Persero) Tbk.
       - [ Translate this page ]
      File Format: PDF/Adobe Acrobat - Quick View
      19 Jan 2010 ... Natal Argawan Pardede. Corporate Secretary. Ph. 6221-8192808 / 08111988685. Faks. 6221-85911969. Email, natal. argawan@wika. co. id.
      www.idx.co.id/.../685DA3AF-4163-4141-87D8-F3BFE3704715.PDF - Similar
      iMuL's Virtual Home - Karya Pemenang Ke-2 Kisah Seru di - www ...
       - [ Translate this page ]
      29 Sep 2010 ... www.wika.co.id. Browse by Subject - PSAS IR. Abdul Ran, Mohd Zariat (2007) Bacaan Hermeneutik Terhadap Karya Perang A. Samad Said. ...
      analisis efektifitas dan efisiensi terhadap return harga saham ppt ...
       - [ Translate this page ]
      18 Okt 2010 ... 9. http://learningcenter.wika.co.id/FILES/eureka_page... ppt description: Eskalasi harga (penyesuaian harga komponen biaya konstruksi selama ...
      www.linkpdf.com/.../analisis-efektifitas-dan-efisiensi-terhadap-return-harga-saham-.ppt - Cached
      piutang usaha ppt - Free Download Ebook PDF Search Engine Makalah ...
       - [ Translate this page ]
      6. http://learningcenter.wika.co.id/FILES/eureka_page... ppt description: Beban Penyisihan Piutang; Alokasi Beban Usaha dan Beban Proyek . ...
      www.linkpdf.com/download/3-dl/piutang-usaha-.ppt - Cached
      harga plastik - eBook Downloads
       - [ Translate this page ]
      ... (pabrik metal untuk spare part kendaraan, tangki elpiji dan plastik ... www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf - View ...
      pdfcatch.net/ebook/harga+plastik/ - Cached
      Sucipto Cipto - People / info about name Sucipto Cipto - yasni.com ...
       - [ Translate this page ]
      Tags on Sucipto Cipto: Indonesia, Blogger, Jl.Kyai Adnan, Surabaya, Phone Number, Owner/Entrepreneur, Suwawal Timur, Cipto[at]wika.co.id, Iklan, Address.
      www.yasni.com/sucipto+cipto/check+people - United States
      akden_wika : Message: Re: [akden_wika] Droping Minggu II Juni 2010 ...
       - [ Translate this page ]
      6 posts - 2 authors - Last post: 17 Jun
      If you need Clarification or have received this communication error please notify us immediately by responding to adwijaya@wika.co.id ...
      finance.groups.yahoo.com/group/akden_wika/message/222 - Cached
      Get more discussion results
      PT Wijaya Karya » Info Lowongan Kerja
       - [ Translate this page ]
      17 Okt 2006 ... source: wika.co.id. Join our newsletter to receive job vacancy info lowongan pekerjaan via email, click here ...
      lowongankerja.blogpico.com/2006/10/17/pt-wijaya-karya/ - Cached
      Angkasa Pura Ii Soekarno Hatta | PDF Finder | PDF Search Engine
       - [ Translate this page ]
      ... Pura II PT Angkasa Pura II ... http://www.wika.co.id/data/download/WIKA%207%20September%202009%20(%20Pandu%20Anugrah%20-%20Bahana%20Securities).pdf ...
      www.pdf-finder.com/pdf/angkasa-pura-ii-soekarno-hatta.html - Cached
      Situs Informasi Perpajakan Bagi Profesional - www.bobbang.com
       - [ Translate this page ]
      www.wika.co.id. PT BANK RAKYAT INDONESIA (PERSERO) Tbk DAN ANAK PERUSAHAAN. Tagihan wesel ekspor adalah wesel ekspor yang dinegosiasikan secara diskonto dan ...
      TestCompany mail: RE: [obrolan-bandar] Ask Info: IPO Sat NusaPersada
       - [ Translate this page ]
      .(baca profil perusahaan WIKA di www.wika.co.id). Salam,. Rudy. From: obrolan-bandar(*)yahoogroups.com [mailto:obrolan-bandar(*)yahoogroups.com] On Behalf ...
      www.testcompany.com/archive/October2007-42/4658.html - Cached
      PP:Home - www.sinzub.com
       - [ Translate this page ]
      24 Agu 2010 ... www.wika.co.id/data/specialfeatures/Laporan keuangan Q2 2010.pdf ... International. A world. www.wika.co.id. MEDIA PENILAI INTERNAL ...
      Situs Resmi Pemerintah Kabupaten Klungkung
       - [ Translate this page ]
      ... Http://www.yellowpages.com Http://www.yellowpages.co.id Http://www.pu.go.id Http://www.wika.co.id Http://www.waskita.co.id Http://www.trakindo.co.id ...
      www.klungkungkab.go.id/main.php/webmail/gsp/?go=kritik... - Cached
      Pengendalian Risiko Lingkungan Di Kantor Kesehatan pdf document, ebook
       - [ Translate this page ]
      ... pelaksanaan kesehatan dan keselamatan kerja. M. Pengelolaan Lingkungan PT ... http://www.wika.co.id/data/specialfeatures/CODE%20OF%20CONDUCT%202009.pdf ...
      ebookpedia.net/.../pengendalian-risiko-lingkungan-di-kantor-kesehatan.html - United States - Cached
      Arsip UA - www.aseanmusic.com
       - [ Translate this page ]
      13 Mar 2009 ... www.wika.co.id. Setelah Pabrik Dikuasai Tentara. Itu sebabnya, PT Amerin Abdi kini memerkarakan kesewenang-wenangan itu ke Pengadilan Wira ...
      WebMii - Marga Tama
       - [ Translate this page ]
      http://www.wika.co.id/data/download/Projected%20Invesment%202008.pdf. Display all results. Alexander's Gas & Oil Connections - Indonesia and Malaysia . ...
      www.webmii.es/Result.aspx/Marga/Tama - Cached
       - [ Translate this page ]
      Dalam persen | In ... pembangkit tenaga listrik dan industri berat. Spesialisasi ini sangat diperlukan oleh ... www.wika.co.id | View PDF | Download PDF ...
      www.pdf.kq5.org/search/logam+berat+imbal - Cached
      Conservation International Wikipedia Bahasa Indonesia - Low Diet ...
       - [ Translate this page ]
      ... 2005 ... belum tersedia dalam Bahasa Indonesia - not yet available in Indonesian. ... with the Indonesian contractor PT Wijaya Karya at www.wika.co.id), ...
      www.lowdietonline.com/.../conservation+international+wikipedia+bahasa+indonesia - United States - Cached
      Katalog Produk: Logo Design - Bee Creative - Indonesia
       - [ Translate this page ]
      E-mail: grafis@wika.co.id. Nomer HP: 0813 15887089. Nomer Telpon: 6221-94522402. Nomer Faks: 6221-8191235. Alamat: Gedung WIKA Jl. DI. Panjaitan Kav.9 ...
      beecreative.indonetwork.co.id/1768314/logo-design.htm - Cached
      fizziedotcom.blogspot.com - www.wunwan.com
       - [ Translate this page ]
      29 Okt 2008 ... Pipeline as of May 2008 (in billion Rp) Source: Company. www.wika.co.id. Surat Perjanjian (Kontrak) Kerja Jasa Konsultansi | INKINDO ...
      Permana Jayawirya Bani Dipa - Silahkan Kunjungi....
       - [ Translate this page ]
      Posted on Nov 15, '07 11:37 PM for everyone, wika.co.id, 6. Link, Semua Tentang CAD Posted on Nov 14, '07 9:07 PM for everyone ...
      permanajayawirya.multiply.com/links - Cached
      Ayo gabung di milis masalah psikologi bayi - Bayi - Forum Diskusi ...
       - [ Translate this page ]
      11 posts - 10 authors - Last post: 26 Dec 2005
      add aku ya di melanie@wika.co.id. Thx. Shinta Devi 12/15/2006 5:44:00 PM. ikutan dong... emailku devimachmud@yahoo.com. Nita Novianti ...
      www.parenting.co.id/forum/forum_detail.asp?catid=&pg... - Cached
      Get more discussion results
      List of results for: `revisi tahun 2009`. Download and read the ...
       - [ Translate this page ]
      http://www.wika.co.id/data/download/WIKA_0501_SeI_Sektor Prospektif di Tahun 2009.pdf. Tags: WIKA , 0501 , SeI , Sektor , Prospektif , Tahun , 2009pdf ...
      www.hqpdf.com/list/key+revisi+tahun+2009 - Cached
      [ac-i] Lomba Tulis dan Foto utk Jurnalis
       - [ Translate this page ]
      20 Des 2009 ... wika.co.id - identitas penulis dicantumkan di belakang amplop atau di dalam email - pengiriman artikel dari tanggal 20 Desember 2009 sampai ...
      www.mail-archive.com/artculture...com/msg04636.html - Cached - Similar
      PT Wijaya Karya (Persero)
       - [ Translate this page ]
      26 Jul 2010 ... via email to pramusinto@wika.co.id or novita@wika.co.id. Not later than 30 July 2010. Feedjit Live Blog Stats ...
      cdcumy.blogspot.com/2010/07/pt-wijaya-karya-persero.html - Cached
      PT Wijaya Karya
       - [ Translate this page ]
      20 posts - 15 authors - Last post: 2 Sep
      PT Wijaya Karya (Persero) Tbk planted 1.000 mangroves in Pasanggrahan Bali (4/6). ... www.wika.co.id - Cache. Link to external site ...
      companydatabase.org/search.php?rt=more&st=PT+Wijaya... - Cached
      Get more discussion results
      LP3I LAMPUNG | Facebook
       - [ Translate this page ]
      Lamaran lengkap dikirim melalui email: erik@wika.co.id. Trims. 16. februar kl. 17:42 · Kommenter · Lik dette · Rapporter ...
      nn-no.facebook.com/group.php?gid=78485732787&v... - Norway - Cached
      sman3bdg86 : Message: Re: [sman3bdg86] Fwd: AIR SEMBAHYANG
       - [ Translate this page ]
      28 posts - 6 authors - Last post: 2 Nov 2009
      denden<denfazri@yahoo.com>; deni<deni.armand@wika.co.id>; Destinia Jenialita<jenialita@yahoo.ca>; Dini Ganda May<aganda@slingshot.co.nz>; ...
      groups.yahoo.com/group/sman3bdg86/message/2033 - Cached
      Get more discussion results

    * Everything

    * Images
    * Videos
    * News
    * Books
    * Places
    * Blogs
    * Updates
    * Discussions


    * Kuala Lumpur, Federal Territory of Kuala Lumpur

    * Auto-detected

Change locationClose
Search Options

    *Search settings | Sign in
Advanced search
Page 4 of 345 results (0.11 seconds) 
Search Results

      innova 2010 bandung pdf - Free unlimited eBook search and download.
       - [ Translate this page ]
      3. Phone: (62-22) 4213375 ... http://www.wika.co.id/data/download/BNI Sekuritas, 29 April 2010.pdf bni sekuritas 29 april 2010 wika co id big youth ...
      www.ebookf.com/in/innova-2010-bandung-book.pdf - Cached
      microsoft powerpoint 9 bpkp pdf - Free unlimited eBook search and ...
       - [ Translate this page ]
      (PEMERINGKATAN PEFINDO) ... 9,80. 147,02. Operating Expense. (155,00). (160,78). (In Billion IDR) ... http://www.wika.co.id/data/download/Company Update.pdf ...
      www.ebookf.com/mi/microsoft-powerpoint-9-bpkp-book.pdf - Cached
      Show more results from ebookf.com
       - [ Translate this page ]
      Keuangan Nomor: KEP-401/BL/2008 Peraturan XI ... http://www.wika.co.id/data/specialfeatures/LAPKEU%20PT%20WIKA%20SEPT%202009.pdf ...
      www.pdf-finder.com/pdf/.../KEPUTUSAN-DIREKSI-PT.html - Cached
       - [ Translate this page ]
      Wika.co.id. IN.03.00/A.DIR.0003/2005 about allowance for doubtfull account, yang diterima ... Based on equity method, investment cost is. www.wika.co.id ...
      Arif Dhani Irwanto - People / info about name Arif Dhani Irwanto ...
       - [ Translate this page ]
      7 Okt 2010 ... P A S A R H A R I I N I. Kemungkinan Indeks akan Berbalik Arah. Wijaya Karya (WIKA) ... Arif Irwanto. ext. 3919 … www.wika.co.id ...
      www.yasni.com/arif+dhani+irwanto/check+people - United States
      Sahid Sahirman Memorial Hospital - People / info about name Sahid ...
       - [ Translate this page ]
      Vice President of Indonesia Jussuf Kalla inaugurated Sahid Sahirman Memorial Hospital accompanied by Governor of Jakarta Fauzi Bowo, … www.wika.co.id ...
      www.yasni.com/sahid+sahirman+memorial.../check+people - United States
      Show more results from yasni.com
      Data Proyek Makassar - JEVUSKA
       - [ Translate this page ]
      ... lampung, cibinong, jatiwangi, boyolali, pasuruan dan makassar. Source: http://www.wika.co.id/data/download/Samuel%20Sekuritas%207%20juli%20o8.pdf ...
      www.jevuska.com/topic/data+proyek+makassar.html - Indonesia - Cached
      Contoh Pltu Di Indonesia - JEVUSKA
       - [ Translate this page ]
      ... pembangunan pltu 2 banten labuan 2 x contoh dari salah. Source: http://www.wika.co.id/data/download/WIKA_0624_UpdateLabuan_ver.3.0_webina.pdf ...
      www.jevuska.com/topic/contoh+pltu+di+indonesia.html - Indonesia - Cached
      Samepoint Social Conversation Search Eddy Wijaya | page 2 of ...
       - [ Translate this page ]
      Negatives Words: (None found in this post) | + Positive Words: (None found in this post). Tweet - Original on: wika.co.id - Search this source ...
      www.samepoint.com/docs.php?page=2&q=Eddy... - United States - Cached
      Samepoint Social Conversation Search Dhani Pratama | page 4 of ...
       - [ Translate this page ]
      Negatives Words: (None found in this post) | + Positive Words: (None found in this post). Tweet - Original on: wika.co.id - Search this source ...
      www.samepoint.com/docs.php?page=4&q=Dhani... - United States - Cached
      Free Harian Umum Rakyat Merdeka Download - InfoFilm.info
       - [ Translate this page ]
      21 Okt 2010 ... Download your favorite harian suara merdeka com at http://www.wika.co.id//download/WIKA_0809_Rakyat Merdeka_Wika Garap ...
      infofilm.info/find/free-harian-umum-rakyat-merdeka-download.html - Cached
      IP 1521 3235 445 298998 992 0 1240 http://piwik.org/faq/general ...
      ... 360 157515 508 0 722 http://www.telkom.net.id/ Fast 36 70 54 6688 24 0 33 http://www.fast.net.id/ Wika 7 7 4 70 7 0 4 http://www.wika.co.id/ Iconpln 6 7 ...
      pregool.com/piwik/?module=API&method...1... - Cached
      saham ppt~9 - Find-Docs.com - Free Documents Search Engine
       - [ Translate this page ]
      view - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1... download - learningcenter.wika.co.id/FILES/eureka_page2f1e0a1. ...
      www.find-docs.com/saham-ppt~9.html - Cached
      analisis faktor faktor yang mempengaruhi profitabili ppt ppt ...
       - [ Translate this page ]
      10. http://learningcenter.wika.co.id/FILES/eureka_page... ppt description: Informasi yang ada dalam. Laporan Keuangan. Analisis dan Temukan. ...
      www.linkpdf.com/.../analisis-faktor-faktor-yang-mempengaruhi-profitabili-ppt--.ppt - Cached
      Widjanarko Tantono - Pipl Profiles
       - [ Translate this page ]
      [ www.wika.co.id ]. CATUR,INSAN,PERTIWI,DISTRIBUTOR,kadin,SAHARJO,JAKARTA ... [ www.wika.co.id ]. Surakarta,Yogyakarta,Klaten,Semarang,Magelang,Budi,Agus ...
      pipl.com/directory/name/Tantono/Widjanarko - United States
      Previous posts - Belajar - Internet, Sistem, Informasi, Tutorial ...
       - [ Translate this page ]
      PT Wijaya Karya Tbk http://www.wika.co.id. PT Waskita Karya http://www.waskita.co.id. Konsultan Konstruksi PT Indah Karya http://www.indahkarya.com ...
      adegustiann.blogsome.com/category/alamat-situs/page/1/ - Indonesia - Cached
      Sistem Informasi Manajemen & E-bisnis: Jawaban Ujian Akhir Mata ...
       - [ Translate this page ]
      5 Sep 2007... Management http://www.wika.co.id/eng/company_info/index.php?act=knowledge; Danamon Awards2006 http://www.danamon.co.id/content_a.php? ...
      simeb.blogspot.com/.../ujian-mata-kuliah-simeb-soal-2.html - Cached - Similar
      asia85 : Message: RE: [asia85] Confirm ikutan halal bil halal di ...
       - [ Translate this page ]
      21 posts - 4 authors - Last post: 9 Oct 2008
      ... ikank@yahoo. com; jthoha@hotmail. com; juliansjah_2006@ yahoo.com; kanca@minanga. co.id; neneng@wika. co.id; ningzachriah@ yahoo.com; ...
      dir.groups.yahoo.com/group/asia85/message/15?l=1 - Cached
      Get more discussion results
      asia85 : Message: Re: Konon.....Re: [asia85] Confirm ikutan halal ...
       - [ Translate this page ]
      ... neneng@wika. co.id; ningzachriah@ yahoo.com; satriopwm@yahoo. com; rico_ori@cbn. net.id; adrianti@staff. . gunadarma. ac.id; shintasaelan@ yahoo.com; ...
      dir.groups.yahoo.com/group/asia85/message/27 - Cached
      asia85 : Message: Pengajian ASIA '85
       - [ Translate this page ]
      1 post - Last post: 18 Feb 2009
      <naning@bali- invest.com>; Neneng Rachmawati <neneng@wika. co.id>; Petty > Wong <pettywong@halconpri mo.com>; "rajabahrin@ gmail.com" ...
      dir.groups.yahoo.com/group/asia85/message/173?var=1 - Cached
      Get more discussion results
      Berita Anak Hilang | Facebook
       - [ Translate this page ]
      Maaf,,ketika nyampe ke email sy,,tidak ada foto terlampir nya..di log sy ,email ini pertama dikirim oleh "yoru@wika.co. id" 'TUHAN AKAN MENCATAT SEMUA NIAT ...
      hi-in.facebook.com/topic.php?uid=137426930480... - India - Cached - Similar
       - [ Translate this page ]
      up Koordinator Keuangan dan Akuntansi novita@wika.co.id. Diposkan oleh LOWONGAN WONG SOLO di 23.59 1 komentar · Kirimkan Ini lewat Email BlogThis! ...
      lowonganwongsolo.blogspot.com/ - Cached
      fsrd2001ITB : Message: Re: [fsrd2001ITB] Fwd: Film BOX OFFICE ...
       - [ Translate this page ]
      ... yoppi_p@yahoo.com, Dhoan Kesuma <dhoankesuma@wika.co.id>, ... Titte Nurul Fatima <titte_nf@yahoo.com>, mbak ida <farida.m@wika.co.id>, ...
      movies.groups.yahoo.com/group/fsrd2001ITB/message/1711 - Cached
      Tangerang-Serpong-Karawaci : Message: Fw: [femina & friends] Fw ...
       - [ Translate this page ]
      2 posts - 1 author - Last post: 9 Jul 2008
      ... f annie@wika.co.id; fanny.verawati@amway.com; faried.fahmi@mobile-8.com; Felicia Revitasari; JKT/BankPermata/ID@permatabank.co.id; ...
      groups.yahoo.com/group/Tangerang-Serpong-Karawaci/.../2603 - Cached
      Get more discussion results
      Tangerang-Serpong-Karawaci : Message: Re: [Tangerang-Serpong ...
       - [ Translate this page ]
      2 posts - 1 author - Last post: 10 Jul 2008
      ... f annie@wika. co.id; fanny.verawati@ amway.com; faried.fahmi@ mobile-8. com; Felicia Revitasari; JKT/BankPermata/ ID@permatabank. co.id; ...
      groups.yahoo.com/group/Tangerang-Serpong.../2605 - Cached - Similar
      Show more results from groups.yahoo.com
      Get more discussion results
      mengenal majalengka melalui blog: Mei 2009
       - [ Translate this page ]
      Wika:www.wika.co.id situs Departemen Pendidikan Majalengka:www.depdiknas.go.id situs Pelangi pendidikan:www.dit-plp.go.id ...
      taufikrahmathidayatsmkpariwisata.blogspot.com/2009_05_01_archive.html - Cached
      Wika-co-id - GIGA-PULSA.COM Pusat Pulsa Paling Murah
       - [ Translate this page ]
      4 Okt 2010 ... Wika.co.id is a domain controlled by two name servers at net.id. Both are on the same IP network. The primary name server is ns1.indo.net.id ...
      www.giga-pulsa.com/topik/wika-co-id - Cached
      nikonschoolindonesia : Message: Fw: [nikonschoolindonesia] Re: DPS ...
       - [ Translate this page ]
      10 Feb 2010... <constantine_ rules_666@ yahoo.com>; <dwi_mandhiri@ kod eco.co. id>; <dwimandhiri@ gmail.com>; <wawan.m@wika. co.id>; <zakky@.... id>; ...
      tech.groups.yahoo.com/group/nikonschoolindonesia/message/356 - Cached
      Migas_Indonesia : Message: (adm) Daftar Anggota Baru 16/31-01-2005
       - [ Translate this page ]
      http://www.wika.co.id. Gedung WIKA Jln. D.I. Panjaitan, Cawang, Jakarta Timur 13340. Jabatan : Piping Engineer Bidang Keahlian : Piping Engineering ...
      tech.groups.yahoo.com/group/Migas_Indonesia/message/26932 - Cached
      Www-wika-co-id - job-e-list.com
       - [ Translate this page ]
      Phone 62 21 8192808 8508640 8508650 Fax 62 21 8191235 8199713 Homepage http www wika co id Email adwijaya wika co id..... Read more >> ...
      Buku-wika-inggris-4 - job-e-list.com
       - [ Translate this page ]
      BUKU WIKA INGGRIS 4 http www wika co id data specialfeatures prospectus pdf 0 Vote Up Vote Down 0 Loading Download Social and Economic Conditions in. ...
      MAJALENGKA: Seni Sampyong
       - [ Translate this page ]
      15 Mei 2009 ... http://www.majalengkakab.go.id · http://www.smkn1majalengka.sch.id · http://www.ikmi.ac.id · http://www.telkom.co.id · http://www.wika.co.id ...
      junardi-smkn1majalengka.blogspot.com/2009/.../seni-sampyong.html - Cached
      Berita tentang indonet co id | Berita Terkini
       - [ Translate this page ]
      mail wika co id. Wika.co.id is a domain controlled by two name servers at net.id. ... http://www.robtex.com/dns/mail.wika.co.id.html ...
      zeuder.co.cc/news/indonet+co+id - Cached
      THE CONTRIBUTOR: Cara Pendaftaran Menjadi Member Blog The Contributor
       - [ Translate this page ]
      27 Okt 2009 ... http://feri82.blogspot.com · http://portal.wika.co.id · http://webmail.wika.co.id · http://www.duniatekniksipil.web.id · http://www.gmail. ...
      ccp7.blogspot.com/.../cara-pendaftaran-menjadi-member-blog.html - Cached
      THE CONTRIBUTOR: August 2009
       - [ Translate this page ]
      http://feri82.blogspot.com · http://portal.wika.co.id · http://webmail.wika.co.id · http://www.duniatekniksipil.web.id · http://www.gmail.com ...
      ccp7.blogspot.com/2009_08_01_archive.html - Cached
      wikakaltim : Message: Fw: Terima kasih (dari Pak Gouw , master ...
       - [ Translate this page ]
      2 posts - 1 author - Last post: 13 Apr
      PT. WIJAYA KARYA (Persero) Tbk. Special Area and Overseas Dept. Area VII - KALTIM KALBAR http://www.wika.co.id/ ... aminudin azis ...
      asia.groups.yahoo.com/group/wikakaltim/message/20 - Cached
      Get more discussion results
      Pt Excelcomindo Pratama Tbk Dan Anak Perusahaan Laporan Keuangan ...
       - [ Translate this page ]
      30 Jun 2008 ... Mandiri Dipta Cipta . PT ... http://www.wika.co.id/data/specialfeatures/Laporan Keuangan PT WIKA Tbk. September 2008.pdf; Preview Maximize ...
      www.pdfph.com/.../pt-excelcomindo-pratama-tbk-dan-anak-perusahaan-laporan-keuangan-konsolidasian-30-juni-2008-dan-2007/ - Cached
      Laporan Keuangan Bank Bri .pdf Download
       - [ Translate this page ]
      2751189909. 446296470. PT. Bank Syariah BRI ... http://www.wika.co.id/data/specialfeatures/WIKA KONSOLIDASI - MARET 2010.pdf; Preview Maximize ...
      www.pdfph.com/pdf/laporan-keuangan-bank-bri/ - Cached
      Show more results from pdfph.com
      wika i girder pdf no
       - [ Translate this page ]
      15 Sep 2010 ... http://www.wika.co.id/eng/projects/index.php .... TECHNICAL REQUIREMENT AS SLIPULATED BY WIKA ... http://eproc.wika.co.id/english/tengah.php ...
      www.96147.com/no/wika%20i%20girder.html - Cached
      program audit kewajiban lancar pdf other
       - [ Translate this page ]
      Amanah ... Employee Stock Ownership Program /MESOP). yang ... http://www.wika.co.id/data/download/LAPKEU%20MARET%202009%20-%20REVISED.pdf ...
      www.96147.com/.../program%20audit%20kewajiban%20lancar.html - Cached
      wika i girder pdf other
       - [ Translate this page ]
      By this experience WIKA KAWASAKI (Japan) JO entrusted to handle and accomplish Railway Double ... http://www.wika.co.id/eng/projects/index.php ...
      www.96147.com/other/wika%20i%20girder.html - Cached
      Show more results from 96147.com
      Wika-co-id-site-info - Lowongan Kerja Terbaru
       - [ Translate this page ]
      wika co id is ranked number 719 746 in the world according to the Alexa ... Bank PT Wijaya Karya Tbk Website http www wika co id Email adwijaya wika co id. ...
      Www-wika-co-id - Lowongan Kerja Terbaru
       - [ Translate this page ]
      Phone 62 21 8192808 8508640 8508650 Fax 62 21 8191235 8199713 Homepage http www wika co id Email adwijaya wika co id..... Read more >> ...
      Whois Report for wika.co.id, wika.co.id Whois, Domain Whois Lookup ...
      WhatIsMyIP.com.np is the easiest way to determine your IP address.
      www.whatismyip.com.np/wika.co.id - Cached
      WWW.KORO-KORO.CO.ZA. www.aida.co.za, www.genetics.com.hk, www ...
      23 Feb 2007 ... Www.wika.co.id, www.sucons.com, www.echonindustries.com, www.daegaya.net amritsar.nic.in www.ifp.org.za www.epaolo.com www.bonedry.co.za ...
      yalcemi.001webs.com/koro-koro.co.za.html - Cached

In order to show 
          o The web
          o Pages from Malaysia

Fewer search toolsMore search tools

          o The web
          o Pages from Malaysia

Fewer search toolsMore search tools

Search within results Search Help Give us feedback
Google HomeAdvertising ProgramsPrivacyAbout Google
          o The web
          o Pages from Malaysia

Fewer search toolsMore search tools
    o The web
          o Pages from Malaysia

Fewer search toolsMore search tools


The Most Addictive Game On The Web!